ESTScan Details for Unigene SGN-U562800

Score 
1922
Direction 
Forward
Predicted Peptide Sequence 
MSWADSVSAAENLAGAPSKSAYVPPHLRNRPSTDPPAQASYAGAAASLGNDHSGYGVPNMVGSRWSGQRNEYQSGYAGGGGRGGGWNGRS
GGWDRGRVREVNPFTNDDSEPVTEQESSAINFDAYEDIPVETSGDNVPPPVNTFAEIDLGEAVNENIRRCKYVKPTPVQRHAIPISLAGR
DLMACAQTGSGKTAAFCFPIISGIMRGQFPRPPRPRMAFPLALILSPTRELSCQIHDEAKKFSYQTGVRVVVAYGGAPINQQLRELERGV
HILVATPGRLVDLLERARVSLQMIRYLALDEADRMLDMGFEPQIRKIVQQMDMPPPGVRQTMLFSATFPKEIQRLASDFLSSYIFLAVGR
VGSSTDLIVQRVEYVQETDKRSHLMDLLHAQKENGVHGKQALTLVFVETKKGADALEHWLCMNGFPAAAIHGDRTQQEREHALRSFKTGY
TPILVATDVAARGLDIPHVAHVVNFDLPNDIDDYVHRIGRTGRAGKTGLATAFFNENNSSLARSLSDLMQEANQEVPAWLSRFAARSTYG
GKNRRGGARFGARDFRRDSSYNRGASGGSTDYYGGGANMNSGYASGGYNASYGTAGVTSAWANQPHFAPLANSVVLSSSTLAKLLTLEVT
LAIPHSC*
Predicted Coding Sequence 
ATGTCGTGGGCTGATTCTGTTTCTGCAGCCGAGAATCTGGCTGGAGCTCCGTCTAAGTCAGCATATGTTCCACCACATTTGCGAAACAGA
CCTTCAACTGATCCTCCTGCACAGGCTTCGTATGCTGGGGCTGCTGCATCATTAGGTAATGACCATAGTGGTTATGGTGTCCCAAATATG
GTTGGGAGTCGTTGGAGTGGTCAAAGGAATGAATACCAATCTGGTTATGCTGGTGGAGGAGGACGTGGTGGTGGTTGGAATGGAAGAAGT
GGTGGTTGGGATCGTGGGAGGGTTCGGGAAGTTAACCCCTTTACAAATGATGATAGTGAACCTGTTACTGAACAAGAAAGTTCTGCGATC
AATTTTGATGCATATGAGGATATTCCAGTGGAAACAAGCGGGGATAATGTGCCCCCTCCTGTGAATACTTTTGCAGAGATTGATTTAGGT
GAAGCTGTCAATGAAAATATAAGGAGGTGCAAGTATGTTAAGCCGACCCCTGTGCAACGGCATGCTATACCTATTTCACTCGCAGGGAGG
GATTTGATGGCTTGTGCTCAGACTGGTTCTGGAAAAACTGCTGCTTTCTGCTTCCCAATCATAAGTGGGATCATGAGGGGCCAATTTCCT
AGACCTCCTCGTCCACGTATGGCATTTCCTCTAGCTCTTATTCTCTCCCCGACTAGGGAGCTCTCATGCCAAATTCATGACGAGGCTAAA
AAGTTTTCATATCAAACTGGCGTCAGGGTGGTTGTTGCCTATGGTGGTGCTCCTATAAACCAACAGCTTCGTGAGTTAGAGAGAGGTGTG
CATATTCTTGTAGCAACCCCTGGACGGTTGGTAGATTTACTTGAGAGAGCAAGAGTCTCGTTGCAGATGATAAGGTATTTGGCTCTAGAC
GAGGCTGACCGGATGCTTGACATGGGTTTTGAACCTCAAATAAGGAAAATAGTGCAACAGATGGACATGCCTCCGCCAGGTGTGCGACAG
ACCATGCTTTTCAGTGCCACTTTTCCAAAAGAGATTCAGAGACTGGCCTCAGATTTTCTATCCAGTTATATCTTTTTGGCCGTCGGAAGG
GTCGGCTCTAGCACAGATTTGATTGTCCAACGAGTTGAATATGTTCAAGAGACTGACAAGAGAAGTCACTTGATGGATCTTCTTCATGCG
CAGAAGGAAAATGGTGTTCATGGCAAGCAAGCTCTTACCCTTGTTTTTGTGGAGACTAAGAAGGGAGCTGATGCACTGGAGCATTGGCTT
TGTATGAATGGTTTCCCTGCTGCTGCTATTCATGGTGATAGAACTCAGCAGGAGAGAGAGCATGCCCTCAGATCCTTCAAAACTGGTTAC
ACACCAATCTTGGTTGCAACAGATGTGGCAGCACGTGGTCTCGATATCCCCCATGTTGCACATGTTGTTAACTTTGATCTGCCAAATGAC
ATTGATGACTATGTGCACCGTATTGGAAGAACTGGACGAGCAGGAAAAACAGGTTTAGCTACTGCCTTCTTCAACGAGAACAATTCTTCA
CTTGCAAGATCACTATCCGACCTGATGCAAGAAGCAAACCAAGAAGTACCTGCTTGGCTCTCTCGCTTTGCTGCTCGATCCACTTATGGA
GGCAAGAATCGTCGTGGTGGAGCTCGTTTTGGTGCTCGTGACTTTCGAAGAGATTCCTCTTATAACCGAGGTGCTAGTGGTGGTTCTACC
GACTATTATGGTGGTGGTGCCAATATGAACAGTGGCTATGCATCTGGGGGGTATAATGCATCGTATGGAACAGCAGGCGTGACCAGTGCA
TGGGCTAACCAGCCTCATTTCGCCCCACTAGCTAATTCAGTTGTACTTTCAAGTTCTACTCTAGCAAAACTACTCACTTTAGAGGTTACT
CTTGCTATTCCTCACTCTTGTTAG
Edits in Original Sequence 
GAGGCAAAAATTTAGGCTAGCCGCAATCAAGAACTGTGTATACATAACGTACGGAGAAGTCTCAATTCTCTCCACTGGCTGATTTGAGAC
TTGGGGAATTTGAATTTGATTTGATGATGACGAAAGTTGCTGGGTTTTGATCTGAAATTTTTGTTTTGGGGAGGTTAAGTAGCTTGGATT
TGTAAAATTAGCTGAAATTTTGGTTTTAGGGGTATCTTCTTTGTTTTTTTTTTTTTTGTTTTTTTTTTGGTAACTTGAGGGAAGGTAAAG
AGTGTGTGATCTTTGGGTATTTTGACTATGTCA
(5')ATGTCGTGGGCTGATTCTGTTTCTGCAGCCGAGAATCTGGCTGGAGCTCCGTC
TAAGTCAGCATATGTTCCACCACATTTGCGAAACAGACCTTCAACTGATCCTCCTGCACAGGCTTCGTATGCTGGGGCTGCTGCATCATT
AGGTAATGACCATAGTGGTTATGGTGTCCCAAATATGGTTGGGAGTCGTTGGAGTGGTCAAAGGAATGAATACCAATCTGGTTATGCTGG
TGGAGGAGGACGTGGTGGTGGTTGGAATGGAAGAAGTGGTGGTTGGGATCGTGGGAGGGTTCGGGAAGTTAACCCCTTTACAAATGATGA
TAGTGAACCTGTTACTGAACAAGAAAGTTCTGCGATCAATTTTGATGCATATGAGGATATTCCAGTGGAAACAAGCGGGGATAATGTGCC
CCCTCCTGTGAATACTTTTGCAGAGATTGATTTAGGTGAAGCTGTCAATGAAAATATAAGGAGGTGCAAGTATGTTAAGCCGACCCCTGT
GCAACGGCATGCTATACCTATTTCACTCGCAGGGAGGGATTTGATGGCTTGTGCTCAGACTGGTTCTGGAAAAACTGCTGCTTTCTGCTT
CCCAATCATAAGTGGGATCATGAGGGGCCAATTTCCTAGACCTCCTCGTCCACGTATGGCATTTCCTCTAGCTCTTATTCTCTCCCCGAC
TAGGGAGCTCTCATGCCAAATTCATGACGAGGCTAAAAAGTTTTCATATCAAACTGGCGTCAGGGTGGTTGTTGCCTATGGTGGTGCTCC
TATAAACCAACAGCTTCGTGAGTTAGAGAGAGGTGTGCATATTCTTGTAGCAACCCCTGGACGGTTGGTAGATTTACTTGAGAGAGCAAG
AGTCTCGTTGCAGATGATAAGGTATTTGGCTCTAGACGAGGCTGACCGGATGCTTGACATGGGTTTTGAACCTCAAATAAGGAAAATAGT
GCAACAGATGGACATGCCTCCGCCAGGTGTGCGACAGACCATGCTTTTCAGTGCCACTTTTCCAAAAGAGATTCAGAGACTGGCCTCAGA
TTTTCTATCCAGTTATATCTTTTTGGCCGTCGGAAGGGTCGGCTCTAGCACAGATTTGATTGTCCAACGAGTTGAATATGTTCAAGAGAC
TGACAAGAGAAGTCACTTGATGGATCTTCTTCATGCGCAGAAGGAAAATGGTGTTCATGGCAAGCAAGCTCTTACCCTTGTTTTTGTGGA
GACTAAGAAGGGAGCTGATGCACTGGAGCATTGGCTTTGTATGAATGGTTTCCCTGCTGCTGCTATTCATGGTGATAGAACTCAGCAGGA
GAGAGAGCATGCCCTCAGATCCTTCAAAACTGGTTACACACCAATCTTGGTTGCAACAGATGTGGCAGCACGTGGTCTCGATATCCCCCA
TGTTGCACATGTTGTTAACTTTGATCTGCCAAATGACATTGATGACTATGTGCACCGTATTGGAAGAACTGGACGAGCAGGAAAAACAGG
TTTAGCTACTGCCTTCTTCAACGAGAACAATTCTTCACTTGCAAGATCACTATCCGACCTGATGCAAGAAGCAAACCAAGAAGTACCTGC
TTGGCTCTCTCGCTTTGCTGCTCGATCCACTTATGGAGGCAAGAATCGTCGTGGTGGAGCTCGTTTTGGTGCTCGTGACTTTCGAAGAGA
TTCCTCTTATAACCGAGGTGCTAGTGGTGGTTCTACCGACTATTATGGTGGTGGTGCCAATATGAACAGTGGCTATGCATCTGGGGGGTA
TAATGCATCGTATGGAACAGCAGGCGTGACCAGTGCATGGGaCTAACCAGCCTCATTTCGCCCCACTAGCTAATTCAGTTGTACTTTCAA
GTTCTACTCTAGCAAAACTACTCACTTTAGAGGTTACTCTTGCTATTCCTCACTCTTGTTAG(3')TTTCTCTTCCGTTGTACTCGAGTT
TTTACTTTCCATGGTGGTGTTGTCGTTCGTGACATATAGTTCAGGGCTCTAGGGGATGCGTAAATCTTGGCAGGTCCGCGGCAAATAATG
ACTAACACATTAGGAATTTTTTGCCTCATTAGAAATGTGGTTTATACTTCTCTTAACTCAATTTTGTTGGTTGTAGATCTCTTCTGCAGA
GCCCTTTGAACCAAATGTTTGAAGTTATGTTTCTACTTTAGTCAGTACTGTTGTAATATTCTGAAGTCTTTCTTATTAATCAAATTTTCT
ATTTTATACAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan