ESTScan Details for Unigene SGN-U563057

Score 
972
Direction 
Forward
Predicted Peptide Sequence 
GGNHLTFARTKKIMAETQETVSKSVQELANTNQVPEKYIYAQGSINTYPLLFDVPQVDLSLLTSPNRQQQLNKLQSGLKSCGCIQVINHG
MEDSFLDKVREISKKFFALPTEEKLKYARTVNQIEGYGNDKVLTDKQRLDWSDRLCLNVFPEDIRELRFWPQKPECFREVFEEYMKNMKL
LSESLLKAMAASLNVEENCFLDQCGERGMTTARFNFYPPCPRPDVVLGVKQHADASAITILLQDKEVEGLQVLKDDQWFRVPVVPYGLLI
NVGDQVEVMSNGIFKSPVHRVVTNAERERNSLAVFIMPDVHVGIGPVEKLINEERPRGYKDIKNYVALFFQSYQQGKIPIEAAKISQEFH
*
Predicted Coding Sequence 
GGGGGCAACCACCTAACATTTGCTCGTACAAAAAAAATTATGGCTGAAACTCAAGAAACAGTTTCCAAATCAGTACAAGAACTAGCAAAT
ACCAATCAAGTTCCAGAAAAGTATATTTATGCACAAGGATCAATCAATACCTATCCTCTTTTGTTCGATGTGCCACAAGTTGATCTTAGC
CTTCTCACATCCCCTAACAGACAACAACAGCTCAACAAACTTCAATCAGGTCTCAAGTCTTGTGGCTGTATCCAGGTCATAAATCATGGA
ATGGAAGATTCATTTCTTGACAAAGTGCGTGAAATAAGCAAAAAGTTCTTTGCTCTTCCAACTGAAGAGAAGCTTAAATATGCAAGAACA
GTTAATCAAATTGAAGGATACGGAAATGATAAAGTTCTTACAGATAAGCAAAGGCTTGATTGGTCCGATAGACTGTGTCTAAATGTGTTC
CCTGAAGATATAAGAGAACTCCGATTCTGGCCACAAAAACCTGAATGTTTTAGGGAAGTTTTTGAAGAATATATGAAGAATATGAAGTTG
TTGAGTGAGTCCCTCCTAAAGGCCATGGCAGCGTCATTGAACGTGGAGGAGAATTGCTTTCTGGACCAGTGTGGAGAACGTGGGATGACT
ACTGCAAGATTCAACTTCTACCCTCCGTGTCCAAGACCTGATGTGGTACTCGGAGTCAAACAACATGCTGATGCATCGGCCATTACCATC
CTGTTGCAAGACAAAGAAGTTGAAGGGCTTCAGGTTCTCAAAGATGATCAATGGTTCAGAGTGCCTGTTGTCCCATATGGTTTACTCATC
AATGTTGGAGATCAAGTTGAGGTAATGAGCAATGGCATCTTTAAAAGCCCGGTGCACAGGGTGGTGACGAATGCAGAACGAGAAAGAAAT
AGCCTTGCTGTCTTCATTATGCCAGATGTACATGTTGGGATTGGACCAGTAGAGAAGCTTATCAACGAGGAAAGGCCGAGAGGGTACAAG
GACATTAAGAATTATGTTGCTCTCTTCTTCCAAAGCTATCAGCAGGGGAAAATACCAATAGAAGCAGCAAAGATAAGCCAAGAATTTCAT
TAG
Edits in Original Sequence 
(5')GGGGGCAACCACCTAACATTTGCtTCGTACAAAAAAAATTATGGCTGAAACTCAAGAAACAGTTTCCAAATCAGTACAAGAACTAG
CAAATACCAATCAAGTTCCAGAAAAGTATATTTATGCACAAGGATCAATCAATACCTATCCTCTTTTGTTCGATGTGCCACAAGTTGATC
TTAGCCTTCTCACATCCCCTAACAGACAACAACAGCTCAACAAACTTCAATCAGGTCTCAAGTCTTGTGGCTGTATCCAGGTCATAAATC
ATGGAATGGAAGATTCATTTCTTGACAAAGTGCGTGAAATAAGCAAAAAGTTCTTTGCTCTTCCAACTGAAGAGAAGCTTAAATATGCAA
GAACAGTTAATCAAATTGAAGGATACGGAAATGATAAAGTTCTTACAGATAAGCAAAGGCTTGATTGGTCCGATAGACTGTGTCTAAATG
TGTTCCCTGAAGATATAAGAGAACTCCGATTCTGGCCACAAAAACCTGAATGTTTTAGGGAAGTTTTTGAAGAATATATGAAGAATATGA
AGTTGTTGAGTGAGTCCCTCCTAAAGGCCATGGCAGCGTCATTGAACGTGGAGGAGAATTGCTTTCTGGACCAGTGTGGAGAACGTGGGA
TGACTACTGCAAGATTCAACTTCTACCCTCCGTGTCCAAGACCTGATGTGGTACTCGGAGTCAAACAACATGCTGATGCATCGGCCATTA
CCATCCTGTTGCAAGACAAAGAAGTTGAAGGGCTTCAGGTTCTCAAAGATGATCAATGGTTCAGAGTGCCTGTTGTCCCATATGGTTTAC
TCATCAATGTTGGAGATCAAGTTGAGGTAATGAGCAATGGCATCTTTAAAAGCCCGGTGCACAGGGTGGTGACGAATGCAGAACGAGAAA
GAAATAGCCTTGCTGTCTTCATTATGCCAGATGTACATGTTGGGATTGGACCAGTAGAGAAGCTTATCAACGAGGAAAGGCCGAGAGGGT
ACAAGGACATTAAGAATTATGTTGCTCTCTTCTTCCAAAGCTATCAGCAGGGGAAAATACCAATAGAAGCAGCAAAGATAAGCCAAGAAT
TTCATTAG(3')CTGATGTTGGTTCCTTCTTTTCCTCTATTTGTATGTTCACTAGTCGTGGTTGCCTGTGCTGCGCACGAGCCCAACACT
AAGATCTGGACATGCTCTAAGAAGGGTAAGCTCTTGAATATAAGCAAGACAACGGATTGATCTACAACCTATTGTTATTCATTTACGAAA
TATACTAAATGCATAATATGTACCAAAAATAGGAGTAAGGTGCGCGTACACCTAACCTTCCTAAACCTTACTTGTGAGACTAAACTGATT
ATATTATTGCTGTGCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan