ESTScan Details for Unigene SGN-U563100

Score 
855
Direction 
Forward
Predicted Peptide Sequence 
XVTIHWHGVRQMRTGWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIINPKEGVIYPFPKPKRETPILLGEW
WNTNPIDVVRQATRTGAAPNISDAYTINSQPGDLYKCSSQDTAIVHMDSGEINLLRVINAALNQQLFFAVANHKLTVVGADATYVKPFTT
SVLMLGPGQTTDVLIKADQQPARYYMAARAYASAQDAPFDDTTTTAILEYNTASCSTNCVKTKPVFPSLPAYNDTSTATTFSTKFRSPRR
VEVPKEIDENLFFTVGLGLENCPRGAPSSYCQGPSGTRFTASMNNVSFTLPSNNSPXYKHITKAYLGVFSTDFPAX
Predicted Coding Sequence 
XXGGTTACTATTCACTGGCATGGTGTTAGGCAAATGAGAACAGGATGGGCAGATGGACCAGAATTTATCACTCAGTGCCCGATTAGACCA
GGAAAGAGTTACACTTACCGGTTTACTATTCAAGGACAAGAAGGGACTCTTTGGTGGCACGCCCACAGCTCGTGGCTTAGGGCTACTGTT
TATGGAGCTTTAATTATCAATCCAAAAGAAGGAGTAATCTATCCATTTCCAAAGCCCAAAAGAGAAACACCAATTCTGCTCGGTGAGTGG
TGGAATACGAACCCTATTGACGTTGTAAGACAAGCAACAAGAACAGGAGCAGCTCCTAATATATCTGATGCATACACCATCAATTCTCAA
CCAGGTGACCTCTACAAGTGTTCTAGTCAAGATACCGCCATAGTTCATATGGACTCTGGTGAAATCAACCTCCTTCGAGTTATCAACGCT
GCCCTGAACCAGCAGCTTTTCTTTGCTGTGGCCAATCACAAACTTACTGTCGTTGGAGCAGATGCCACTTATGTTAAACCCTTCACAACA
TCAGTCCTTATGCTCGGACCAGGCCAGACAACTGATGTCCTGATCAAAGCTGATCAACAACCCGCTCGATATTACATGGCAGCACGTGCC
TATGCTAGTGCTCAAGACGCCCCTTTTGATGATACCACAACCACAGCCATCCTCGAGTACAACACAGCTTCTTGTTCTACGAATTGTGTC
AAGACCAAACCGGTTTTCCCATCTTTACCAGCATATAATGACACATCCACTGCCACAACTTTCTCAACCAAATTCAGAAGCCCAAGAAGG
GTCGAGGTTCCCAAGGAAATCGATGAAAATCTGTTCTTCACAGTTGGGCTGGGACTCGAGAACTGCCCAAGAGGTGCACCCTCCAGTTAC
TGTCAAGGTCCAAGTGGAACTCGATTCACTGCGAGTATGAACAATGTATCTTTTACGCTACCATCCAATAATTCCCCTGXCTACAAGCAC
ATTACCAAGGCATATCTGGGTGTTTTCTCAACTGATTTCCCAGCTGXX
Edits in Original Sequence 
(5')XXGGTTACTATTCACTGGCATGGTGTTAGGCAAATGAGAACAGGATGGGCAGATGGACCAGAATTTATCACTCAGTGCCCGATTAG
ACCAGGAAAGAGTTACACTTACCGGTTTACTATTCAAGGACAAGAAGGGACTCTTTGGTGGCACGCCCACAGCTCGTGGCTTAGGGCTAC
TGTTTATGGAGCTTTAATTATCAATCCAAAAGAAGGAGTAATCTATCCATTTCCAAAGCCCAAAAGAGAAACACCAATTCTGCTCGGTGA
GTGGTGGAATACGAACCCTATTGACGTTGTAAGACAAGCAACAAGAACAGGAGCAGCTCCTAATATATCTGATGCATACACCATCAATTC
TCAACCAGGTGACCTCTACAAGTGTTCTAGTCAAGATACCGCCATAGTTCATATGGACTCTGGTGAAATCAACCTCCTTCGAGTTATCAA
CGCTGCCCTGAACCAGCAGCTTTTCTTTGCTGTGGCCAATCACAAACTTACTGTCGTTGGAGCAGATGCCACTTATGTTAAACCCTTCAC
AACATCAGTCCTTATGCTCGGACCAGGCCAGACAACTGATGTCCTGATCAAAGCTGATCAACAACCCGCTCGATATTACATGGCAGCACG
TGCCTATGCTAGTGCTCAAGACGCCCCTTTTGATGATACCACAACCACAGCCATCCTCGAGTACAACACAGCTTCTTGTTCTACGAATTG
TGTCAAGACCAAACCGGTTTTCCCATCTTTACCAGCATATAATGACACATCCACTGCCACAACTTTCTCAACCAAATTCAGAAGCCCAAG
AAGGGTCGAGGTTCCCAAGGAAATCGATGAAAATCTGTTCTTCACAGTTGGGCTGGGACTCGAGAACTGCCCAAGAGGTGCACCCTCCAG
TTACTGTCAAGGTCCAAGTGGAACTCGATTCACTGCGAGTATGAACAATGTATCTTTTACGCTACCATCCAATAATTCCCCTGXCTACAA
GCACATTACCAAGGCATATCTGGGTGTTTTCTCAACTGATTTCCCAGCTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan