ESTScan Details for Unigene SGN-U563223

Score 
1055
Direction 
Forward
Predicted Peptide Sequence 
MEHHTTTSRAEAERLLGVAEKLLRDKEFAPCKDFALLAQETEPLLEGPDQILAIAEVLLASVKRINNHHDWYSILQIQGRTEDSELIKKQ
YRRLALLLHPDKNKYPSSDTAFGLVADAWAVLSDPSKKGLYDNELSLFGRVKLTPSARRGRPRGSYNKQKKGDAKLPVRRSSRASNSGSG
QNQNPNPSPVSQKSYHSAPPKATAPAPMSGAMRGQRVVNLWTACPYCYNLYEYPRVYEGVVYDVINVKXAFTATEILSMPPMVPGKEAYY
CIWGFFPMGFVNGNLEDLGTVKGAAAAAATTGAFPTWMPPMFSTQNAANNQQNATPIPATVQVTNPAPAAASAPPPPAPPAAAAPRPMST
GPKKRGRPRKYN*
Predicted Coding Sequence 
ATGGAGCATCATACAACTACAAGCAGAGCAGAAGCAGAGAGACTGTTAGGAGTTGCAGAAAAGCTGTTAAGAGATAAAGAATTTGCCCCT
TGTAAAGATTTTGCACTTCTTGCTCAAGAAACCGAGCCTTTACTTGAAGGACCTGACCAGATCTTAGCAATTGCTGAAGTTCTTTTAGCT
TCTGTTAAACGAATCAACAATCACCATGATTGGTACTCTATTCTTCAAATCCAAGGTCGTACTGAAGATTCAGAGCTTATCAAGAAACAG
TATCGTCGTCTTGCTCTTCTTCTTCATCCTGATAAAAACAAATACCCATCTTCAGATACTGCTTTCGGCCTTGTTGCTGATGCTTGGGCT
GTTCTTTCAGATCCATCAAAAAAGGGTCTTTATGATAATGAACTTTCCCTTTTTGGTAGAGTTAAATTGACTCCTTCTGCTCGACGAGGA
AGACCTAGAGGGAGTTATAATAAGCAGAAGAAAGGAGATGCGAAGTTACCTGTGAGGAGGAGTAGTCGAGCGAGTAATTCGGGTTCGGGT
CAAAATCAGAACCCTAATCCCAGTCCGGTGAGTCAGAAGAGTTATCATAGTGCGCCGCCGAAGGCTACGGCGCCGGCGCCGATGAGTGGT
GCGATGAGAGGGCAAAGGGTGGTGAATTTGTGGACGGCGTGTCCGTATTGTTACAATTTGTATGAGTATCCTAGGGTTTATGAAGGTGTT
GTTTACGATGTGATAAATGTAAAAGXGGCTTTTACTGCTACTGAGATTTTGTCAATGCCACCAATGGTGCCAGGGAAAGAAGCTTATTAT
TGCATTTGGGGTTTTTTTCCAATGGGTTTTGTGAATGGGAATTTGGAGGATTTGGGTACTGTCAAAGGAGCTGCTGCTGCTGCTGCAACT
ACTGGTGCATTTCCAACTTGGATGCCACCGATGTTTTCGACTCAAAATGCTGCGAATAATCAACAAAATGCTACTCCAATTCCAGCTACG
GTTCAGGTAACGAATCCAGCGCCAGCXGCGGCCTCAGCTCCTCCTCCTCCTGCTCCTCCTGCTGCTGCTGCTCCCAGACCAATGTCGACA
GGACCTAAGAAAAGAGGTAGGCCTAGGAAGTATAACTAA
Edits in Original Sequence 
TTTTACACTCGATAGTTACACCCCACTACCCCCCACCCCACCCCCTCTTCCTCTTCCCCAAATCAACCATCAATTTCTCCGTCTCCATTT
CAGATCAAACCCCCAAAGCCCTAAAATCCCCAAAAATTGAGGAAAAA
(5')ATGGAGCATCATACAACTACAAGCAGAGCAGAAGCAGAG
AGACTGTTAGGAGTTGCAGAAAAGCTGTTAAGAGATAAAGAATTTGCCCCTTGTAAAGATTTTGCACTTCTTGCTCAAGAAACCGAGCCT
TTACTTGAAGGACCTGACCAGATCTTAGCAATTGCTGAAGTTCTTTTAGCTTCTGTTAAACGAATCAACAATCACCATGATTGGTACTCT
ATTCTTCAAATCCAAGGTCGTACTGAAGATTCAGAGCTTATCAAGAAACAGTATCGTCGTCTTGCTCTTCTTCTTCATCCTGATAAAAAC
AAATACCCATCTTCAGATACTGCTTTCGGCCTTGTTGCTGATGCTTGGGCTGTTCTTTCAGATCCATCAAAAAAGGGTCTTTATGATAAT
GAACTTTCCCTTTTTGGTAGAGTTAAATTGACTCCTTCTGCTCGACGAGGAAGACCTAGAGGGAGTTATAATAAGCAGAAGAAAGGAGAT
GCGAAGTTACCTGTGAGGAGGAGTAGTCGAGCGAGTAATTCGGGTTCGGGTCAAAATCAGAACCCTAATCCCAGTCCGGTGAGTCAGAAG
AGTTATCATAGTGCGCCGCCGAAGGCTACGGCGCCGGCGCCGATGAGTGGTGCGATGAGAGGGCAAAGGGTGGTGAATTTGTGGACGGCG
TGTCCGTATTGTTACAATTTGTATGAGTATCCTAGGGTTTATGAAgGGTGTTGTTTACGATGTGATAAATGTAAAAGXGGCTTTTACTGC
TACTGAGATTTTGTCAATGCCACCAATGGTGCCAGGGAAAGAAGCTTATTATTGCATTTGGGGTTTTTTTCCAATGGGTTTTGTGAATGG
GAATTTGGAGGATTTGGGTACTGTCAAAGGAGCTGCTGCTGCTGCTGCAACTACTGGTGCATTTCCAACTTGGATGCCACCGATGTTTTC
GACTCAAAATGCTGCGAATAATCAACAAAATGCTACTCCAATTCCAGCTACGGTTCAGGTAACGAATCCAGCGCCAGCXGCGGCCTCAgG
CTCCTCCTCCTCCTGCTCCTCCTGCTGCTGCTGCTCCCAGACCAATGTCGACAGGACCTAAGAAAAGAGGTAGGCCTAGGAAGTATAACT
AA(3')AAAAGGTTTGATTTTTATGGTTTGTCTCAAGAATTTTGAGTCTTATGGAGATTATAATGTTTAGTTTGATCAAGTCGACTGGAA
TTGAATGATCGATCGAATCTTGTAGTAAGTTGAGTAGTGAGCAAAAGTAGTTGCTTTTCTTTACTCATCATATGAAGAAGTATATAACTG
CAGAACTGTGCTGTAGCTTGTTCTTGTTAGATGCCTTGTGTTTGTAGAAATTTCTCGTTGTTGGTAGATTTTCTGCGGTTTGTAGGTACT
ATATTTATTCAATTGTCAAGACTCGTAGTCATAGACTCGTTTTGTAATTGAATGATCTTTATACCAAATTTCGAAATTCTAATTTCTGTC
TGTTCAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan