ESTScan Details for Unigene SGN-U563252

Score 
761
Direction 
Forward
Predicted Peptide Sequence 
LVKEDSTRKNXNWIEYLFQFVAKGLDFGALLIRKAEKRKMEEDQVGSTRRSRRMRITAGDTDDRGWTPLHIVARKGDLKQVRRLLNEGMD
ANVMAGGPKSFGMTPLHLAAKGGHVRVMDELLERGADIDARAKGACAWTPLHHAAKEKKKKAIKFLIRNGAFLPDDISDTRFNPPLHYCP
GLEWAYEEMKLLQLESSSSGEASYSSEN*
Predicted Coding Sequence 
CTGGTGAAAGAAGATTCTACAAGAAAGAATAXGAATTGGATTGAGTATTTGTTTCAATTTGTGGCAAAAGGATTGGATTTTGGAGCTTTG
CTTATTAGGAAAGCGGAGAAGAGGAAAATGGAGGAGGATCAGGTTGGTTCGACTCGACGATCGAGAAGAATGCGTATAACTGCAGGTGAT
ACGGATGATCGCGGTTGGACTCCACTTCACATTGTTGCTCGGAAAGGTGACCTGAAACAGGTTAGAAGGCTTCTTAATGAAGGTATGGAT
GCAAATGTGATGGCAGGAGGCCCAAAATCATTTGGTATGACCCCACTTCATCTTGCTGCTAAGGGAGGTCACGTGAGAGTTATGGATGAA
TTACTTGAGAGGGGTGCTGATATCGATGCTCGAGCCAAGGGTGCATGTGCATGGACTCCTCTCCATCATGCTGCGAAAGAGAAAAAGAAG
AAAGCGATTAAATTCTTGATTAGAAATGGTGCATTTTTGCCAGATGACATCTCTGACACCAGGTTCAATCCACCACTTCACTATTGTCCT
GGTCTTGAATGGGCATATGAGGAGATGAAGCTGCTTCAGCTAGAGAGTTCATCATCTGGCGAGGCCTCCTACAGCTCGGAAAACTGA
Edits in Original Sequence 
CGGCCGGGGATCCTCCTCAAAAATTCTAGGGTTTCTCTTCTTCCTTCTTCCTCCCAATTCCTTCAAAACCCAAGCCTAATCAAACAAGAA
AATCCCTTTATCAATACTTATGCAACCTCCAAACATATTCCAAATTCATCAAGGATTCATATAATAGCCCTTTTTTTCCCCGTAAAAAAA
CAGCTATTATATATATATATATATATTGTTTGCGTGGTTTTTTGCATTGATAATGATAATCTCTGCTTTCCTTCGTTTCACTTCATCTTG
TGTGTTCAATAAGCTTACAAATCTTCGTGTTTTTGGTCCTGGATTGAACCCTTTTGGTCCTTACAACTTGGCTAATCATTCCTCTCGCTA
AAGCCCTAATTTTTTTCTTGGTTGGTTGTTTGCCTCTGGATCATGTAAAATTGAAGGTTGTTTCAGAAGATTATCACTTGTTTTGGTTCT
TGTCTATTGAAGACTTTTCTGGGTTTCTCTCATAGTCGGAAGACAGATCAATCTTGTTGGTCAAAGTTATTAGTTTTATGTAAAAGGTCT
TGTTTTGGTGTATTGAGATTCAGTTACTGATATACAAGTAGAGTCTTTAGACTTGTTGATTAGGTTTTCGAAATTTCTCTTCCGGACA
(5')
CTGGTGAAAGAAGATTCTACAAGAAAGAATAXGAATTGGATTGAGTATTTGTTTCAATTTGTGGCAAtAAGGATTGGATTTTGGAGCT
TTGCTTATTAGGAAAGCGGAGAAGAGGAAAATGGAGGAGGATCAGGTTGGTTCGACTCGACGATCGAGAAGAATGCGTATAACTGCAGGT
GATACGGATGATCGCGGTTGGACTCCACTTCACATTGTTGCTCGGAAAGGTGACCTGAAACAGGTTAGAAGGCTTCTTAATGAAGGTATG
GATGCAAATGTGATGGCAGGAGGCCCAAAATCATTTGGTATGACCCCACTTCATCTTGCTGCTAAGGGAGGTCACGTGAGAGTTATGGAT
GAATTACTTGAGAGGGGTGCTGATATCGATGCTCGAGCCAAGGGTGCATGTGCATGGACTCCTCTCCATCATGCTGCGAAAGAGAAAAAG
AAGAAAGCGATTAAATTCTTGATTAGAAATGGTGCATTTTTGCCAGATGACATCTCTGACACCAGGTTCAATCCACCACTTCACTATTGT
CCTGGTCTTGAATGGGCATATGAGGAGATGAAGCTGCTTCAGCTAGAGAGTTCATCATCTGGCGAGGCCTCCTACAGCTCGGAAAACTGA
(3')GGCAGAATCGAATGTGTTCCAAGTGTTGTTGGTGTGTAGAGTTCAAGATGGACTCCTCTCAATGTTATCTACTGCATATTAAGTAG
TGTCGTCAGTCTACTCAAGTGTTGCGTTTGGATTTGATATGTTCTCTATCTTTGTGATTTGCGTGTTTGGTATTTTACCAAGTAGTTGTT
ACTGTGACTCGATCACTGTAAACAATCTCTCTCTCTCTGTTCACCATTTGCTATAACTGTGTGACATGTCGTCAAAAAAACATTTCATAT
GTGAAAAGAAAACAATATGATTGTGGGTTTTGCGAGTTCTAAATAATTTTGCCTTGGAGCTGTTCTTGTTTGGCTCATAAGTGATGTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan