ESTScan Details for Unigene SGN-U563325

Score 
414
Direction 
Forward
Predicted Peptide Sequence 
XIGVFFTRIRVNFSASKGXDSGGKICRSATAAFFGFKCSYTVLDDLKYTVLQEGEIESSFSDIHMEMLRYFGGFCDTEWHTDWRSQKELP
KSYSQTMECNKDEAFRAKKIAERKFEQKDYAGAKKFALKAQVLYPGLDDLTQMLTTFDVYISAENKVSGEVDWYGVLGVSPSSDDETVNK
QYRKLALVLHPDKNKSIGAEGAFQLLSEAWSLLSDXIQKVGIYPDKEFKRSP
Predicted Coding Sequence 
XXCATAGGGGTTTTTTTCACAAGAATACGGGTAAATTTTAGTGCGTCAAAGGGTCXTGACTCTGGTGGGAAAATTTGTAGGTCAGCAACA
GCAGCTTTTTTTGGATTCAAATGCTCATATACGGTATTGGATGATTTGAAGTATACTGTGCTTCAAGAAGGGGAGATTGAGTCATCATTT
TCTGATATTCACATGGAAATGCTTAGATATTTTGGTGGTTTCTGTGATACCGAGTGGCATACTGACTGGAGATCACAAAAGGAACTTCCA
AAATCATATTCACAAACTATGGAGTGTAATAAAGATGAAGCCTTCAGAGCAAAAAAAATTGCAGAGCGGAAGTTTGAACAGAAGGATTAT
GCTGGTGCAAAGAAATTTGCCTTGAAAGCTCAGGTTTTGTATCCAGGGCTTGACGATTTAACCCAGATGTTAACAACATTTGATGTTTAC
ATCTCTGCCGAAAACAAAGTAAGTGGGGAAGTGGATTGGTATGGGGTACTTGGTGTGAGCCCGTCAAGTGATGATGAAACGGTAAACAAA
CAGTACAGGAAGCTAGCTCTTGTCCTCCACCCTGATAAAAATAAATCTATTGGTGCTGAAGGTGCATTTCAACTTCTCTCTGAGGCCTGG
AGCTTGTTATCTGATAAXATCCAAAAGGTTGGCATATACCCAGACAAGGAGTTCAAAAGGTCCCCX
Edits in Original Sequence 
(5')XXCATAGGGGTTTTTTTCACAAGAATACGGGTAAATTTTAGTGCGTCAAAGGGTCXTGACTCTGGTGGGAAAATTTGTAGGTCAGC
AACAGCAGCTTTTTTTGGATTCAAATGCTCATATACGGTATTGGATGATTTGAAGTATACTGTGCTTCAAGAAGGGGAGATTGAGTCATC
ATTTTCTGATATTCACATGGAAATGCtTTAGATATTTTGGTGGTTTCTGTGATACCGAGTGGCATACTGACTGGAGATCACAAAAGGAAC
TTCCAAAATCATATTCACAAACTATGGAGTGTAATAAAGATGAAGCCTTCAGAGCAAAAAAAATTGCAGAGCGGAAGTTTGAACAGAAGG
ATTATGCTGGTGCAAAGAAATTTGCCTTGAAAGCTCAGGTTTTGTATCCAGGGCTTGACGATTTAACCCAGATGTTAACAACATTTGATG
TTTACATCTCTGCCGAAAACAAAGTAAGTGGGGAAGTGGATTGGTATGGGGTACTTGGTGTGAGCCCGTCAAGTGATGATGAAACGGTAA
ACAAACAGTACAGGAAGCTAGCTCTTGTCCTCCACCCTGATAAAAATAAATCTATTGGTGCTGAAGGTGCATTTCAACTTCTCTCTGAGG
CCTGGAGCTTGTTATCTGATAAXATCCAAAAGGTTGGCATATACCCAGACAAGGAGTTCAAAAGGTCCCCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan