ESTScan Details for Unigene SGN-U563397

Score 
441
Direction 
Reverse
Predicted Peptide Sequence 
XSSDLSLLDYGFVIPSNPYDCIELKYDAALLDAASMAAGFTSPKLLLAIPMAAADFMHLNLDGPNSDLKVTLGGGELVEGRLLAALRVVL
SNDEEAVKQHDLETLKSLTVEAPLGISTEVSALRTVVALCVIALGHFPTKIMEDKSLLKQNVSPTTELALQFRIQKKSLIVDVMRDLSKX
GKVTPCQVVNVLVXHYPFLIITVVPELAYISSNSTGYLLPPISRXYRVTLFTKACGHHLIDTSTNFGNFGDYGEYGVG*
Predicted Coding Sequence 
XTAAGTAGTGATCTTTCTCTTCTGGACTATGGATTCGTCATTCCATCAAACCCCTACGACTGCATCGAACTTAAATATGATGCTGCTCTT
CTTGATGCTGCCAGTATGGCTGCAGGGTTTACATCCCCCAAACTTCTCCTCGCCATCCCCATGGCAGCAGCAGATTTTATGCATTTAAAT
CTAGACGGACCAAACTCTGATCTGAAGGTGACACTAGGAGGTGGAGAGCTAGTAGAGGGCCGATTATTAGCAGCCTTGAGAGTTGTCCTG
TCAAACGATGAAGAAGCAGTGAAGCAGCACGACTTAGAGACGCTCAAATCATTGACAGTCGAAGCCCCTCTGGGAATATCAACTGAAGTA
TCAGCTCTTCGCACCGTTGTGGCTTTGTGTGTTATTGCTCTCGGACACTTCCCAACGAAAATCATGGAGGACAAGTCGTTGCTGAAGCAA
AATGTTTCACCTACTACTGAGTTGGCTCTCCAGTTCAGAATACAAAAGAAGTCCCTCATTGTAGATGTTATGAGGGATCTTAGCAAGAXG
GGTAAAGTTACTCCTTGCCAAGTAGTTAATGTACTTGTTGAXCACTATCCTTTTTTAATTATTACTGTGGTGCCCGAGCTAGCTTACATC
TCGAGTAACTCTACGGGGTACCTGCTACCTCCCATTAGTAGAXACTATCGCGTAACTCTATTCACCAAGGCTTGTGGACATCATCTTATT
GACACCTCCACAAATTTCGGAAATTTTGGTGATTATGGAGAGTATGGTGTAGGTTGA
Edits in Original Sequence 
(5')XTAAGTAGTGATCTTTCTCTTCTGGACTATGGATTCGTCATTCCATCAAACCCCTACGACTGCATCGAACTTAAATATGATGCTGC
TCTTCTTGATGCTGCCAGTATGGCTGCAGGGTTTACATCCCCCAAACTTCTCCTCGCCATCCCCATGGCAGCAGCAGATTTTATcGCATT
TAAATCTAGACGGACCAAACTCTGATCTGAAGGTGACACTAGGAGGTGGAGAGCTAGTAGAGGGCCGATTATTAGCAGCCTTGAGAGTTG
TCCTGTCAAACGATGAAGAAGCAGTGAAGCAGCACGACTTAGAGACGCTCAAATCATTGACAGTCGAAGCCCCTCTGGGAATATCAACTG
AAGTATCAGCTCTTCGCACCGTTGTGGCTTTGTGTGTTATTGCTCTCGGACACTTCCCAACGAAAATCATGGAGGACAAGTCGTTGCTGA
AGCAAAATGTTTCACCTACTACTGAGTTGGCTCTCCAGTTCAGAATACAAAAGAAGTCCCTCATTGTAGATGTTATGAGGGATCTTAGCA
AGAXGGGTAAAGTTACTCCTTGCCAAGTAGTTAATGTACTTGTTGAXCACTATCCTTTTTTAATTATTACTGTGGTGCCCGAGCTAGCTT
ACATCTCGAGTAACTCTACGGGGTACCTGCTACCTCCCATTAGTAGAXACTATCGCGTAACTCTATTCACCAAGGCTTGTGGACATCATC
TTATTcGACACCTCCACAAATTTCGGAAATTTTGGTGATTATGGAGAGTATGGTGTAGGTTGA(3')ATTCAACTATTTTTCCTTCATCA
CTTATAGTACACGTGTTTTACGCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan