ESTScan Details for Unigene SGN-U563765

Score 
704
Direction 
Forward
Predicted Peptide Sequence 
VVYKGTLADGTNVAVKKIIESDFQGNDEFCNEVEIISNLKHRNLVSLRGCCVTDKNRIENGESERFLVYDYMPNGNLEDHLFAVNQGGIL
KQPLTWPQRKNIILDVAKGLAYLHYGVKPAIYHRDIKATNILLDEDMRARVADFGLVKQSREGQSHLTTRVAGTHGYLAPEYALYGQLTE
KSDVYSFGVVVLEIMCGRKVLDFSSGSPRSFLITDWAWSKVKAGKMNEVLDAILVKTEDSVSANPRAIMVRFLLVGILCAHVMVALRPTI
LDALKMLEGDIEVPEIPDRPAPLGHPSFYNASGNTFSISPALSCLQMPAGDMLX*
Predicted Coding Sequence 
GTAGTTTATAAAGGAACTTTAGCAGATGGGACTAATGTTGCTGTCAAAAAGATTATAGAATCTGATTTTCAAGGAAATGATGAGTTTTGC
AATGAGGTTGAGATTATTAGTAACTTGAAGCATCGTAATCTTGTATCACTTAGGGGTTGTTGCGTGACAGATAAAAATCGGATTGAAAAT
GGGGAGAGTGAAAGATTCCTCGTGTATGATTACATGCCCAATGGGAATCTTGAGGATCATTTATTTGCTGTAAATCAAGGTGGAATACTG
AAGCAGCCGTTGACTTGGCCTCAGAGAAAAAACATAATTTTGGATGTGGCAAAAGGACTAGCTTATCTGCATTATGGGGTAAAGCCAGCA
ATTTATCACAGGGACATTAAAGCTACTAATATCCTATTAGATGAAGATATGAGAGCAAGAGTTGCTGACTTTGGGTTGGTAAAGCAAAGT
AGAGAAGGACAGTCTCATCTTACCACCAGAGTGGCAGGAACACATGGCTACTTAGCTCCTGAATATGCTCTCTATGGGCAATTGACTGAG
AAGAGCGATGTTTATAGTTTTGGGGTTGTTGTTTTGGAAATAATGTGTGGAAGGAAGGTCCTTGATTTCTCTTCTGGATCGCCTCGTTCT
TTTCTGATCACGGATTGGGCTTGGTCGAAGGTAAAAGCTGGAAAGATGAATGAAGTTTTGGATGCCATCCTAGTAAAGACTGAGGATTCC
GTAAGTGCAAATCCAAGGGCTATAATGGTGAGATTTCTCCTTGTTGGAATATTATGTGCTCACGTGATGGTGGCCTTAAGGCCAACTATA
TTGGATGCACTAAAAATGTTAGAAGGAGATATTGAGGTTCCTGAAATTCCAGACAGACCAGCACCTCTTGGACACCCTTCATTTTATAAT
GCTAGTGGTAACACATTCAGCATATCACCAGCCTTGAGTTGCTTGCAAATGCCTGCTGGAGACATGCTCANGTGA
Edits in Original Sequence 
(5')GTAGTTTATAAAGGAACTTTAGCAGATGGGACTAATGTTGCTGTCAAAAAGATTATAGAATCTGATTTTCAAGGAAATGATGAGTT
TTGCAATGAGGTTGAGATTATTAGTAACTTGAAGCATCGTAATCTTGTATCACTTAGGGGTTGTTGCGTGACAGATAAAAATCGGATTGA
AAATGGGGAGAGTGAAAGATTCCTCGTGTATGATTACATGCCCAATGGGAATCTTGAGGATCATTTATTTGCTGTAAATCAAGGTGGAAT
ACTGAAGCAGCCGTTGACTTGGCCTCAGAGAAAAAACATAATTTTGGATGTGGCAAAAGGACTAGCTTATCTGCATTATGGGGTAAAGCC
AGCAATTTATCACAGGGACATTAAAGCTACTAATATCCTATTAGATGAAGATATGAGAGCAAGAGTTGCTGACTTTGGGTTGGTAAAGCA
AAGTAGAGAAGGACAGTCTCATCTTACCACCAGAGTGGCAGGAACACATGGCTACTTAGCTCCTGAATATGCTCTCTATGGGCAATTGAC
TGAGAAGAGCGATGTTTATAGTTTTGGGGTTGTTGTTTTGGAAATAATGTGTGGAAGGAAGGTCCTTGATTTCTCTTCTGGATCGCCTCG
TTCTTTTCTGATCACGGATTGGGCTTGGTCGAAGGTAAAAGCTGGAAAGATGAATGAAGTTTTGGATGCCATCCTAGTAAAGACTGAGGA
TTCCGTAAGTGCAAATCCAAGGGCTATAATGGTGAGATTTCTCCTTGTTGGAATATTATGTGCTCACGTGATGGTGGCCTTAAGGCCAAC
TATATTGGATGCACTAAAAATGTTAGAAGGAGATATTGAGGTTCCTGAAATTCCAGACAGACCAGCACCTCTTGGACACCCTTCATTTTA
TAATGCTAGTGGTAACACATTCAGCATATCACCAGCCTTGAGTTGCTTGCAAATGCCTGCTGGAGACATGCTCANGTGA(3')CAATATG
AAGTATTCTCATATGACATACTTTTCTTGCTTATTGAGATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan