ESTScan Details for Unigene SGN-U563902

Score 
595
Direction 
Forward
Predicted Peptide Sequence 
XRNLKYSVKSEINNQKSKIMSNLRSICRPQVVYFSITCCCRDLLGKSAVRVSNWNLSSVSRWTKPPVLQSWYHTSSRMETWDHRLNQQRK
MVTTSAYNWNDSKSPYETLELEGDADEEQIKVAYRRLAKFYHPDVYNGRGTLEEGETAEARFIKIQAAYELLIDADERRKYDKDNRVNPM
KASEAWVEWLMKKRKAFDQRGDMAIAAWAEQQQLELNLKARRLARSKMDPEEERRIIAKERKASVENFNNTLKRHTLVLRKRDIMRRKSE
EEKKRVISRLLAAEGLELAEEEIRIYRRCPAYW
Predicted Coding Sequence 
XGTAGAAATCTGAAATACTCTGTGAAGAGTGAAATTAACAATCAAAAATCCAAAATTATGAGCAATTTGAGATCGATTTGTAGACCTCAA
GTTGTGTATTTTTCAATTACTTGTTGTTGCAGAGACTTATTGGGGAAATCGGCAGTTAGGGTTTCAAATTGGAACCTTAGTTCAGTTTCT
CGATGGACTAAACCACCGGTGCTGCAATCATGGTATCATACTTCGAGTAGAATGGAAACTTGGGATCATCGATTGAATCAGCAGAGGAAA
ATGGTGACTACTTCTGCTTATAATTGGAATGATTCAAAGTCTCCTTATGAAACTCTCGAACTAGAAGGGGATGCTGATGAAGAACAAATA
AAAGTGGCATATAGACGATTGGCGAAGTTTTACCATCCAGATGTTTATAATGGCAGAGGGACTCTTGAGGAAGGAGAAACTGCTGAAGCT
CGATTCATTAAGATTCAAGCTGCTTACGAGCTTCTTATAGATGCAGACGAACGGAGAAAATATGATAAAGACAATCGAGTAAACCCCATG
AAGGCATCCGAAGCATGGGTGGAGTGGCTAATGAAAAAGCGAAAAGCATTTGACCAACGGGGTGATATGGCCATTGCTGCATGGGCTGAA
CAGCAGCAGCTAGAACTAAATCTGAAGGCCCGCCGCCTTGCTCGTTCAAAGATGGATCCCGAAGAAGAAAGGCGAATCATTGCTAAAGAG
AGAAAGGCTTCTGTGGAGAATTTTAATAATACGTTAAAGCGACATACACTTGTCTTAAGGAAAAGAGACATAATGCGGCGAAAATCAGAG
GAAGAAAAGAAAAGAGTCATTAGCAGGCTTCTGGCTGCCGAAGGTCTGGAGCTTGCAGAGGAGGAGATAAGAATCTATAGAAGATGCCCC
GCATATTGG
Edits in Original Sequence 
(5')XGTAGAAATCTGAAATACTCTGTGAAGAGTGAAATTAACAATCAAAAATCCAAAATTATGAGCAATTTGAGATCGATTTGTAGACC
TCAAGTTGTGTATTTTTCAATTACTTGTTGTTGCAGAGACTTATTGGGGAAATCGGCAGTTAGGGTTTCAAATTGGAACCTTAGTTCAGT
TTCTCGATGGACTAAACCACCGGTGCTGCAATCATGGTATCATACTTCGAGTAGAATGGAAACTTGGGATCATCGATTGAATCAGCAGAG
GAAAATGGTGACTACTTCTGCTTATAATTGGAATGATTCAAAGTCTCCTTATGAAACTCTCGAACTAGAAGGGGATGCTGATGAAGAACA
AATAAAAGTGGCATATAGACGATTGGCGAAGTTTTACCATCCAGATGTTTATAATGGCAGAGGGACTCTTGAGGAAGGAGAAACTGCTGA
AGCTCGATTCATTAAGATTCAAGCTGCTTACGAGCTTCTTATAGATGCAGACGAACGGAGAAAATATGATAAAGACAATCGAGTAAACCC
CATGAAGGCATCCGAAGCATGGGTGGAGTGGCTAATGAAAAAGCGAAAAGCATTTGACCAACGGGGTGATATGGCCATTGCTGCATGGGC
TGAACAGCAGCAGCTAGAACTAAATCTGAAGGCCCGCCGCCTTGCTCGTTCAAAGATGGATCCCGAAGAAGAAAGGCGAATCATTGCTAA
AGAGAGAAAGGCTTCTGTGGAGAATTTTAATAATACGTTAAAGCGACATACACTTGTCTTAAGGAAAAGAGACATAATGCGGCGAAAATC
AGAGGAAGAAAAGAAAAGAGTCATTAGCAGGCTTCTGGCTGCCGAAGGTCTGGAGCTTGCAGAGGAGGAcGATAAGAATCTATAGAAGAT
GCCCCGCATATTGG(3')TCCGCCTCCACGCACCTGGTGAAGAATACAGCATCTTGGAAAGCTACTTCAGGTTAAAACAATGTATTGTGC
AATACAAGAAGAACCAAAATAGTTATCTTTTTAAGTTATTTAGATGTACATCAATCATAGGTTAACTTTGTACTATACTGAACTTGGCAA
GGTTGAAACGTTTAATTTTCGATTTGCCATTGTTGACTCATTATCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan