ESTScan Details for Unigene SGN-U563918

Score 
666
Direction 
Forward
Predicted Peptide Sequence 
MQGQQNTVGSLQETLGFNHGSTPSEGGVDQQICWSNLQNSAQNHLPDYMVSSNATDIPFFNPMSQERQNVTRGSLGESSSSIAPNSASWS
EQKADHGWSSAMTTYNGPSLICNEQQCGSSNIMSLNDFFSQGSSSSTIPHEINRNPAFEGRSDNNDDGCQGWSVLHTNSVRPGKERMSSA
CTYLGNGCSTDDSGDGRPESSPDSRRFCKRKTLEGYLAQSSGSGSSDYIPLAENSIWHSGTASHSMSTGANISAPTESVRSINMSEHVIP
RLGLTMGGAVAVTPVGTPASRSAESSHRNFRVRIDGSPQQDYLPSNIFPDVDNVGNVNRSSEQQLPELLPNIPLDLRSVPAADSGNTQRQ
PVVMHASSLHRRAQTGGVQHQVPELAAHQVLXRERNSVTFEEPNSRIVSRNISQHPMFIPSTNGRNLNQNPASLNLAGRNVSVAGNVASS
SGVQX
Predicted Coding Sequence 
ATGCAGGGGCAACAGAATACCGTTGGTTCGCTCCAAGAAACTTTAGGTTTTAATCATGGTTCGACGCCTAGTGAAGGTGGTGTAGATCAA
CAGATATGTTGGAGTAATTTGCAAAATTCTGCACAGAATCACCTGCCTGATTATATGGTTTCTTCAAATGCGACTGATATTCCATTCTTC
AATCCTATGAGCCAAGAGAGACAGAATGTAACCAGGGGGAGTTTAGGAGAATCCAGCTCCTCTATTGCACCGAATTCTGCAAGTTGGAGT
GAACAGAAAGCAGATCATGGATGGTCATCCGCAATGACTACATATAATGGACCTTCACTAATCTGTAATGAACAGCAATGTGGGTCTTCT
AACATTATGTCATTGAATGATTTTTTTTCTCAAGGTTCTAGTTCTAGCACCATTCCTCATGAAATCAACAGGAATCCAGCATTTGAGGGG
CGCAGTGACAACAATGACGATGGCTGTCAAGGATGGAGTGTACTCCATACCAATTCTGTTAGACCAGGAAAAGAGCGAATGTCATCTGCT
TGTACTTATTTAGGTAATGGGTGTTCGACGGATGATAGTGGTGATGGCAGGCCAGAAAGTTCACCGGATTCTAGGCGCTTTTGTAAGAGA
AAAACACTTGAAGGATATCTAGCACAATCTTCAGGAAGTGGAAGTTCTGATTATATTCCTCTTGCTGAAAATAGCATATGGCATTCTGGA
ACTGCATCACATAGTATGAGTACAGGTGCAAATATCTCTGCTCCAACTGAAAGTGTCAGAAGCATCAACATGTCTGAGCATGTGATTCCA
AGACTTGGGCTTACCATGGGAGGAGCCGTTGCGGTAACTCCCGTTGGTACTCCGGCTTCAAGAAGTGCAGAAAGTTCTCATAGAAATTTC
AGGGTGAGGATTGATGGCTCACCTCAGCAAGATTATCTTCCCAGTAATATCTTTCCTGATGTGGATAATGTTGGAAATGTTAATCGGTCA
TCTGAACAGCAATTACCAGAGTTACTTCCTAATATCCCTTTGGATTTGAGGTCTGTGCCTGCTGCAGACAGTGGAAATACTCAAAGGCAG
CCTGTTGTAATGCATGCTTCGTCTCTGCATCGACGTGCACAGACTGGTGGAGTTCAGCATCAAGTTCCAGAACTGGCAGCTCATCAAGTT
CTGCXGCGAGAGAGAAATTCAGTAACATTTGAAGAGCCTAACTCAAGAATTGTGTCAAGAAACATCTCACAACATCCTATGTTCATACCT
TCAACTAATGGGAGAAACTTGAACCAAAATCCTGCCAGCTTGAATTTAGCTGGAAGAAATGTTTCTGTTGCTGGAAATGTCGCATCCAGT
TCAGGGGTCCAGTXX
Edits in Original Sequence 
ATCTCTCTCTCCCTCTCTGTGAGAGAATGTATTCCTTCATTTCCTCTTTTCTCCACCCCATCTCTCAAAATCCCTTCTTTCTCTCTCTCT
TCTCTGTTAAGCAGTGAGTTCTGTTGGTTTACATAGATTTGATGTTTCTTCTGGTTGCTGTTTCACTGGTTTGCTAAGGAAAAAGTGTGA
ATCTTCTCACACTACAATACTATCTCAAATCCTCTTTGAGACTGTAAGCTTGGTATACCATAGCTCTA
(5')ATGCAGGGGCAACAGAAT
ACCGTTGGTTCGCTCCAAGAAACTTTAGGTTTTAATCATGGTTCGACGCCTAGTGAAGGTGGTGTAGATCAACAGATATGTTGGAGTAAT
TTGCAAAATTCTGCACAGAATCACCTGCCTGATTATATGGTTTCTTCAAATGCGACTGATATTCCATTCTTCAATCCTATGAGCCAAGAG
AGACAGAATGTAACCAGGGGGAGTTTAGGAGAATCCAGCTCCTCTATTGCACCGAATTCTGCAAGTTGGAGTGAACAGAAAGCAGATCAT
GGATGGTCATCCGCAATGACTACATATAATGGACCTTCACTAATCTGTAATGAACAGCAATGTGGGTCTTCTAACATTATGTCATTGAAT
GATTTTTTTTCTCAAGGTTCTAGTTCTAGCACCATTCCTCATGAAATCAACAGGAATCCAGCATTTGAGGGGCGCAGTGACAACAATGAC
GATGGCTGTCAAGtGATGGAGTGTACTCCATACCAATTCTGTTAGACCAGGAAAAGAGCGAATGTCATCTGCTTGTACTTATTTAGGTAA
TGGGTGTTCGACGGATGATAGTGGTGATGGCAGGCCAGAAAGTTCACCGGATTCTAGGCGCTTTTGTAAGAGAAAAACACTTGAAGGATA
TCTAGCACAATCTTCAGGAAGTGGAAGTTCTGATTATATTCCTCTTGCTGAAAATAGCATATGGCATTCTGGAACTGCATCACATAGTAT
GAGTACAGGTGCAAATATCTCTGCTCCAACTGAAAGTGTCAGAAGCATCAACATGTCTGAGCATGTGATTCCAAGACTTGGGCTTACCAT
GGGAGGAGCCGTTGCGGTAACTCCCGTTGGTACTCCGGCTTCAAGAAGTGCAGAAAGTTCTCATAGAAATTTCAGGGTGAGGATTGATGG
CTCACCTCAGCAAGATTATCTTCCCAGTAATATCTTTCCTGATGTGGATAATGTTGGAAATGTTAATCGGTCATCTGAACAGCAATTACC
AGAGTTACTTCCTAATATCCCTTTGGATTTGAGGTCTGTGCCTGCTGCAGACAGTGGAAATACTCAAAGGCAGCCTGTTGTAATGCATGC
TTCGTCTCTGCATCGACGTGCACAGACTaGGTGGAGTTCAGCATCAAGTTCCAGAACTGGCAGCTCATCAAGTTCTGCXGCGAGAGAGAA
ATTCAGTAACATTTGAAGAGCCTAACTCAAGAATTGTGTCAAGAAACATCTCACAACATCCTATGTTCATACCTTCAACTAATGGGAGAA
ACTTGAACCAAAATCCTGCCAGCTTGAATTTAGCTGGAAGAAATGTTTCTGTTGCTGGAAATGTCGCATCCAGTTCAGGGGTCCAGTXX
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan