ESTScan Details for Unigene SGN-U564122

Score 
734
Direction 
Forward
Predicted Peptide Sequence 
MAVQRGRNGMMGEEDDEGGLFEEELEFEEEPDSHIPLHLRDIFNAAESGDVDALRQALDNFNGNIDEPLEDGDTALHXYLSVWPSGMCGA
TVRGGASVEAKDEDGAIPLHDACAGGYTEIARLLINNAPDPECVKRMLDTFDEEGDAPLHHAARGEHLDVIRLLIASGASACRNNLLGRT
PSELVEPESEACIILDEAISAEIGRPYRST*
Predicted Coding Sequence 
ATGGCGGTACAAAGGGGACGTAACGGCATGATGGGTGAAGAAGATGACGAAGGCGGTTTATTCGAGGAGGAATTGGAGTTCGAAGAAGAG
CCAGATTCTCACATACCTCTTCACCTCCGTGACATTTTCAACGCCGCCGAGTCCGGCGACGTCGACGCCCTTCGCCAAGCCCTAGATAAT
TTTAATGGAAACATTGATGAACCTCTAGAAGATGGGGACACTGCTCTTCATXATTACTTGTCTGTATGGCCATCTGGCATGTGTGGAGCT
ACTGTTAGAGGAGGAGCTTCTGTGGAGGCTAAGGATGAAGATGGAGCAATTCCATTGCATGATGCTTGTGCTGGAGGATACACAGAAATA
GCCCGTCTGCTAATCAACAATGCACCTGACCCTGAATGCGTGAAAAGGATGCTGGACACCTTTGATGAAGAAGGTGATGCGCCTCTCCAT
CATGCCGCCAGAGGTGAACATTTAGATGTGATCAGATTATTGATAGCTTCAGGGGCTTCTGCTTGTAGGAACAATTTATTAGGAAGGACC
CCATCTGAGCTTGTTGAGCCTGAAAGTGAAGCTTGCATAATCTTAGACGAAGCTATAAGTGCTGAAATCGGCCGTCCCTATAGGTCTACG
TAA
Edits in Original Sequence 
GAGAACTTCATATTACGAAATAATTGATTTGTGTTATATCACCAGAAAAAATCGAAGTTACAGAA(5')ATGGCGGTACAAAGGGGACGT
AACGGCATGATGGGTGAAGAAGATGACGAAGGCGGTTTATTCGAGGAGGAATTGGAGTTCGAAGAAGAGCCAGATTCTCACATACCTCTT
CACCTCCGTGACATTTTCAACGCCGCCGAGTCCGGCGACGTCGACGCCCTTCGCCAAGCCCTAGATAATTTTAATGGAAACATTGATGAA
CCTCTAGAAGATGGGGACACTGCTCTTCATXATTACTTGTCTGTATGGCCATCTGGCATGTGTGGAGCTACTGTTAGAGaGAGGAGCTTC
TGTGGAGGCTAAGGATGAAGATGGAGCAATTCCATTGCATGATGCTTGTGCTGGAGGATACACAGAAATAGCCCGTCTGCTAATCAACAA
TGCACCTGACCCTGAATGCGTGAAAAGGATGCTGGACACCTTTGATGAAGAAGGTGATGCGCCTCTCCATCATGCCGCCAGAGGTGAACA
TTTAGATGTGATCAGATTATTGATAGCTTCAGGGGCTTCTGCTTGTAGGAACAATTTATTAGGAAGGACCCCATCTGAGCTTGTTGAGCC
TGAAAGTGAAGCTTGCATAATCTTAGACGAAGCTATAAGTGCTGAAATCGGCCGTCCCTATAGGTCTACGTAA(3')AGAAAATTTGGAC
GCTCGGCTATTGTCGATATGTTTCCCCTTGTTCTGTAGGTACTAGTGTTATATTAGAAACTCGGATATTATGCTTGAATGTTAAAATACT
CTTTATATAGTGAGATTGCACATTGCAGTATGAGAAATACTCATCTTTTTTGAAGCGACTGTTAAATGATTCATCAACTAGAATTATAGA
ATATGGAAACTTTATTTGTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan