ESTScan Details for Unigene SGN-U564311

Score 
145
Direction 
Forward
Predicted Peptide Sequence 
XLDSXQLVEGLSLCDDLLASQSPNRDGNENDQVQKCRPSLADYARLGPEDLKKDLEECQQFVADPANIEIGTPPDFRLSQLEFGSQDSYI
AWGGNKYGFDSAEQNGEIIAHRMLSRLLILRYQIFVKLVVKLVYCKLTETKLDATSFFVTNAAVMPEKAR*
Predicted Coding Sequence 
XXGCTTGATTCTXCACAACTTGTAGAAGGGCTATCCTTATGTGATGATCTTCTCGCGAGCCAGTCTCCTAATAGGGATGGAAATGAAAAT
GACCAAGTGCAGAAATGTAGACCTAGTCTTGCTGATTATGCGCGTTTAGGACCCGAGGATCTGAAGAAGGATTTGGAGGAGTGCCAACAA
TTTGTTGCTGATCCAGCCAACATAGAGATTGGCACTCCACCTGATTTCCGGCTTAGTCAACTTGAGTTTGGATCACAGGACAGTTACATT
GCATGGGGCGGAAACAAGTATGGCTTTGATTCCGCGGAGCAAAATGGTGAAATCATAGCTCATCGAATGCTTTCAAGATTGCTAATCCTT
AGGTATCAGATTTTTGTCAAGCTTGTGGTAAAACTTGTCTACTGCAAGTTAACAGAAACTAAACTTGATGCAACTTCCTTTTTTGTTACC
AATGCXGCGGTAATGCCTGAAAAGGCACGTTAA
Edits in Original Sequence 
(5')XXGCTTGATTCTXCACAACTTGTAGAAGGGCTATCCTTATGTGATGATCTTCTCGCGAGCCAGTCTCCTAATAGGGATGGAAATGA
AAATGACCAAGTGCAGAAATGTAGACCTAGTCTTGCTGATTATGCGCGTTTAGGACCCGAGGATCTGAAGAAGGATTTGGAGGAGTGCCA
ACAATTTGTTGCTGATCCAGCCAACATAGAGATTGGCACTCCACCTGATTTCCGGCTTAGTCAACTTGAGTTTGGATCACAGGACAGTTA
CATTGCATGGGGCGGAAACAAGTATGGCTTTGATTCCGCGGAGCAAAATGGtTGAAATCATAGCTCATCGAATGCTTTCAAGATTGCTAA
TCCTTAGGTATCAGATTTTTGTCAAGCTTGTGGTAAAACTaTGTCTACTGCAAGTTAACAGAAACTAtAACTTGATGCAACTTCCTTTTT
TGTTACCAATGCXGCGGTAATGCCTGAAAAGGCACGTTAA(3')GTGTTTCTGTGCTAGAACGTTCGTTGAACGATCTGGATTTCTTGCT
TAGTTAACCTTGTACATAAGGTTTATTATTACTACTATTTCCTATGCAAGTTTACAACTTTTTCCCTGCTTACTTGGTTTGTGCTTCTTC
ATCTAGCATATGAACTCGATTTGATCTGAAACCTATTGGGATATTGCTCGTTCTAACGAGTTTAGAACGTATCTTCAACTAGTAGTTATC
GCTTATATAGATTTATTTCTTCCTTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan