ESTScan Details for Unigene SGN-U564469

Score 
458
Direction 
Forward
Predicted Peptide Sequence 
RCRSTPSSSSGNKISPAVLFIIVILAIIFFISGVLHLLVRYLMKHRWSSSSSNRDPEMSDSGTYQRQLQQLFHLHDSGLDQAFIDALPVF
LYKEIVGLKEPFDCAVCLCEFSEQDELRLLPLCSHAFHISCIDTWLLSNSTCPLCRGILFTPGFCAENPIFCFDDSIREECSNGGVSEHG
SVVGVGVSPSVKPHEDLDSTISSRRVFSVRLGKFKNTNNSLVENGKREMGETSNSSLDQEGVFQWGLFNMWGMIQNYKWHYVPIXAKNHG
VDGX
Predicted Coding Sequence 
AGATGCAGGTCTACCCCATCATCTTCATCTGGAAACAAAATTAGTCCAGCTGTTCTTTTTATCATAGTAATACTAGCTATCATATTCTTT
ATTTCTGGTGTTCTGCATTTGTTAGTTAGGTATTTGATGAAACATAGGTGGTCTTCTTCTTCATCTAATAGAGACCCTGAAATGTCTGAT
TCTGGTACCTATCAAAGGCAGTTACAACAGCTTTTTCATCTTCATGACTCAGGTTTAGATCAGGCTTTTATTGATGCTCTCCCTGTGTTT
CTTTATAAAGAAATTGTGGGTCTGAAGGAGCCTTTTGATTGTGCTGTTTGTCTTTGTGAGTTTTCAGAACAAGATGAATTGAGGTTGCTC
CCTTTATGTAGTCATGCCTTTCATATAAGTTGTATAGATACATGGTTGTTGTCAAATTCAACTTGCCCCCTTTGTAGAGGAATCCTTTTC
ACACCTGGTTTTTGTGCTGAAAATCCAATCTTTTGCTTTGATGATTCAATAAGAGAAGAATGTAGTAATGGTGGGGTTTCAGAACATGGA
AGTGTTGTTGGTGTTGGTGTTTCTCCTAGTGTAAAACCACATGAGGATTTAGATAGTACTATTAGTTCAAGAAGGGTGTTTTCAGTAAGA
CTTGGCAAATTCAAGAACACAAACAATAGTCTTGTTGAAAATGGAAAAAGGGAAATGGGAGAGACTAGTAACAGTAGTTTGGATCAAGAA
GGTGTTTTTCAATGGGGTCTTTTCAATATGTGGGGGATGATTCAAAATTACAAGTGGCATTATGTCCCAATAGXTGCTAAAAATCATGGT
GTTGATGGTAXX
Edits in Original Sequence 
(5')AGATGCAGGTCTACCCCATCATCTTCATCTGGAAACAAAATTAGTCCAGCTGTTCTTTTTATCATAGTAATACTAGCTATCATATT
CTTTATTTCTGGTGTTCTGCATTTGTTAGTTAGGTATTTGATGAAACATAGGTGGTCTTCTTCTTCATCTAATAGAGACCCTGAAATGTC
TGATTCTGGTACCTATCAAAGGCAGTTACAACAGCTTTTTCATCTTCATGACTCAGGTTTAGATCAGGCTTTTATTGATGCTCTCCCTGT
GTTTCTTTATAAAGAAATTGTGGGTCTGAAGGAGCCTTTTGATTGTGCTGTTTGTCTTTGTGAGTTTTCAGAACAAGATGAATTGAGGTT
GCTCCCTTTATGTAGTCATGCCTTTCATATAAGTTGTATAGATACATGGTTGTTGTCAAATTCAACTTGCCCCCTTTGTAGAGGAATCCT
TTTCACACCTGGTTTTTGTGCTGAAAATCCAATCTTTTGCTTTGATGATTCAATAAGAGAAGAATGTAGTAATGGTGGGGTTTCAGAACA
TGGAAGTGTTGTTGGTGTTGGTGTTTCTCCTAGTGTAAAACCACATGAGGATTTAGATAGTACTATTAGTTCAAGAAGGGTGTTTTCAGT
AAGACTTGGCAAATTCAAGAACACAAACAATAGTCTTGTTGAAAATGGAAAAAGGGAAATGGGAGAGACTAGTAACAGTAGTTTGGAtTC
AAGAAGGTGTTTTTCAATGGGGTCTTTTCAATATGTGGGGGATGATTCAAAATTACAAGTGGCATTATGTCCCAATAGXTGCTAAAAATC
ATGGTGTTGATGGTAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan