ESTScan Details for Unigene SGN-U564485

Score 
506
Direction 
Forward
Predicted Peptide Sequence 
EEGVSDDFIVQLVSEIKAEYFPPKVDIVIQNEIPTDFYIIVSGAVDVVTYKNGMEQFLSKLGSQQMFGEIGVIFNIPQPFTVRTKRLSQV
VRISHHHFKQLVQPLHEDGKIIHTNFIQHLKGLKNEELAEMPLISEFLDDLISEEASMNEAGAQDQQENELSATTSSLSKTPSTRVIIHG
YHPDHKPKSGGKLIHLPDSIENLHSIAESXVWEKRKYDSHGGWFSSRGFGCSERG*
Predicted Coding Sequence 
GAGGAAGGAGTCTCCGACGACTTTATCGTCCAATTGGTATCAGAAATAAAAGCAGAATATTTTCCACCAAAAGTGGATATTGTCATACAA
AATGAGATACCAACAGATTTCTACATTATTGTATCTGGGGCTGTGGATGTTGTAACATACAAGAACGGAATGGAACAATTTTTATCCAAG
TTGGGATCTCAACAAATGTTTGGAGAAATAGGTGTAATATTCAATATCCCTCAACCTTTCACAGTGAGAACTAAAAGGCTTTCTCAAGTT
GTTCGTATTAGTCATCATCATTTCAAGCAATTGGTACAACCCCTTCATGAAGATGGAAAAATAATTCACACTAATTTTATTCAGCATTTG
AAGGGATTGAAAAATGAGGAGCTAGCTGAGATGCCGCTAATATCAGAATTTCTTGATGATTTAATTAGTGAGGAAGCCTCGATGAATGAG
GCCGGAGCTCAAGACCAACAAGAAAACGAGTTATCGGCAACTACTTCTTCGTTATCAAAAACACCTTCTACTAGAGTGATAATTCACGGA
TATCACCCGGATCATAAGCCAAAATCAGGAGGAAAACTTATACATCTACCTGATTCAATTGAAAATCTTCATAGTATTGCAGAAAGTAXA
GTTTGGGAGAAGAGGAAGTACGATTCTCATGGCGGATGGTTCTCAAGTAGAGGATTTGGCTGCTCTGAGAGAGGATGA
Edits in Original Sequence 
(5')GAGGAAGGAGTCTCCGACGACTTTATCGTCCAATTGGTATCAGAAATAAAAGCAGAATATTTTCCACCAAAAGTGGATATTGTCAT
ACAAAATGAGATACCAACAGATTTCTACATTATTGTATCTGGGGCTGTGGATGTTGTAACATACAAGAACGGAATGGAACAATTTTTATC
CAAGTTGGGATCTCAACAAATGTTTGGAGAAATAGGTGTAATATTCAATATCCCTCAACCTTTCACAGTGAGAACTAAAAGGCTTTCTCA
AGTTGTTCGTATTAGTCATCATCATTTCAAGCAATTGGTACAACCCCTTCATGAAGATGGAAAAATAATTCACACTAATTTTATTCAGCA
TTTGAAGGGATTGAAAAATGAGGAGCTAGCTGAGATGCCGCTAATATCAGAATTTCTTGATGATTTAATTAGTGAGGAAGCCTCGATGAA
TGAGGCCGGAGCTCAAGACCAACAAGAAAACGAGTTATCGGCAACTACTTCTTCGTTATCAAAAACACCTTCTACTAGAGTGATAATTCA
CGGATATCACCCGGATCATAAGCCAAAATCAGGAGGAAAACTTATACATCTACCTGATTCAATTGAAAATCTTCATAGTATTGCAGAAAG
TAXAGTTTGGGAGAAGAGGAAGTACGATTCTCATGGCGGATGGTTCTCAAGTAGAGGATTTGGCTGCTCTGAGAGAGGATGA(3')TCAC
TTGTATATTTTTTGAGGAAAAAAAAACAAATGTACTGAAAATATTTTGTGTGTTGATATACTCATATTGAATCTGACAGTAAATATATGG
TAATGAGATTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan