ESTScan Details for Unigene SGN-U564544

Score 
113
Direction 
Reverse
Predicted Peptide Sequence 
KGKFISYFKAGKMFRKGYIYHLIRVHDIKAEALTLQSVSVVNEFPDVFPEELPGLPPEREIEFTIDVLPDTQPISIPPYRMAPAELKELK
EQLRDLLEKGFIRPSTSPWGAPVLFVRKKDGSLRMCIDYRQLNKVTIMNRYPLPRIDDLFDQLQGAKGFSKIDLRSGYHQVRVREADIPM
TAFRTRYGHYVFRVLSFGLTIAPAVFMDXNELSFNPFLDMFVIGFIAAILVYSRSEEEHEDYLSX
Predicted Coding Sequence 
AAAGGTAAGTTCATTTCATACTTCAAGGCCGGGAAGATGTTTAGAAAAGGCTATATTTACCATCTGATTCGGGTGCATGACATAAAGGCA
GAGGCACTGACTCTTCAATCAGTCTCGGTAGTTAATGAATTTCCTGATGTATTCCCCGAGGAACTTCCAGGCCTTCCTCCAGAACGGGAG
ATAGAGTTTACTATAGATGTACTGCCAGATACCCAACCTATATCTATACCTCCTTATAGAATGGCACCTGCTGAGTTGAAAGAATTGAAA
GAGCAATTGAGGGATTTACTAGAAAAGGGCTTCATCAGGCCTAGTACGTCACCTTGGGGAGCACCGGTACTATTTGTGAGGAAGAAGGAT
GGGTCGCTCCGGATGTGCATTGATTATAGGCAGCTGAACAAAGTAACAATAATGAACAGGTATCCCCTCCCAAGGATTGACGATCTATTT
GACCAGTTGCAGGGTGCAAAGGGTTTTTCAAAGATAGACTTGCGGTCAGGTTATCATCAGGTACGGGTTAGGGAGGCAGATATCCCAATG
ACGGCATTCCGGACCCGATATGGGCATTATGTGTTTAGAGTGTTGTCTTTTGGGCTGACTATTGCTCCAGCGGTATTCATGGATTTXAAT
GAATTGAGTTTTAATCCATTCCTTGATATGTTTGTTATTGGATTTATAGCCGCTATTCTGGTCTATTCACGTTCAGAAGAGGAGCATGAA
GACTATTTAAGCTGX
Edits in Original Sequence 
(5')AAAGGTAAGTTCATTTCATACTTCAAGGCCGGGAAGATGTTTAGAAAAGGCTATATTTACCATCTGATTCGGGTGCATGACATAAA
GGCAGAGGCACTGACTCTTCAATCAGTCTCGGTAGTTAATGAATTTCCTGATGTATTCCCCGAGGAACTTCCAGGCCTTCCTCCAGAACG
GGAGATAGAGTTTACTATAGATGTACTGCCAGATACCCAACCTATATCTATACCTCCTTATAGAATGGCACCTGCTGAGTTGAAAGAATT
GAAAGAGCAATTGAGGGATTTACTAGAAAAGGGCTTCATCAGGCCTAGTACGTCACCTTGGGGAGCACCGGTACTATTTGTGAGGAAGAA
GGATGGGTCGCTCCGGATGTGCATTGATTATAGGCAGCTGAACAAAGTAACAATAATGAACAGGTATCCCCTCCCAAGGATTGACGATCT
ATTTGACCAGTTGCAGGGTGCAAAGGGTTTTTCAAAGATAGACTTGCGGTCAGGTTATCATCAGGTACGGGTTAGGGAGGCAGATATCCC
AATGACGGCATTCCGGACCCGATATGGGCATTATGTGTTTAGAGTGTTGTCTTTTGGGCTGACTATTGCTCCAGCGGTATTCATGGATTT
XAATGAATTGAGTaTTTAATCCATTCCTTGATATGTTTGTTATTGGATTTATAGCCGCTATTCTGGTCTATTCACGTTCAGAAGAGGAGC
ATGAAGACTATTTAAGCTGX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan