ESTScan Details for Unigene SGN-U564597

Score 
769
Direction 
Forward
Predicted Peptide Sequence 
YYIVESSSVNSSLYRQHPRRCSFYGELRNIPKNYTFSPTTLTSPHTLDCRVAIRFSATILXESLTAEPSENGVNGGADANNQSFLASYYD
KYPFSPLSQDVSRLTDEIHSMAKNLQKDAPLTEGESSLVLEAESHPPHKVDENLWKNREQLEEILFLLESSNWPPALQLQSTTEDVELVS
VLERLGEKFRSTLKSLQTFQSKNSEFVFNTVMTYMPQDFRGTLIRQQRERSERNKQAEVDALINSGGSIRDRYALLWNQQMERRRQLAQL
GSATGVYKTLVKYLVGVPQVLLDFVQKINDDDGPMEEQRQRYGPPLYSLTKMVLNIRLFLSLLWRRFEAGKLSRSQITVLEEAVDIYTSE
FQRFITFIRDVFANSPFFITAEEAGTLEARKSDEYKEVSVPAGKSHEVSLTVDAINSYIAWDFSLVQGRVDMDIGFSMEYTDPSGQKSKS
YLIDDMELTKGTSVRAXSGNYKLIWDNSYSTFFKKVLRFKVDCIPPVVEPVLSSD*
Predicted Coding Sequence 
TATTATATTGTAGAGTCCTCCTCTGTAAATTCATCTCTTTACCGGCAACACCCCCGTCGGTGTTCCTTTTACGGTGAACTTCGAAATATT
CCAAAGAATTATACCTTTTCGCCGACTACCCTTACTTCTCCTCATACACTTGACTGTAGAGTTGCGATCCGTTTTTCAGCTACTATTCTT
XTTGAGTCTTTGACTGCTGAACCTTCAGAAAATGGCGTCAACGGAGGGGCTGATGCCAATAACCAGAGCTTTCTTGCTTCTTATTATGAT
AAATACCCATTTTCCCCTCTTTCTCAAGATGTATCGCGTCTTACTGATGAAATTCATTCCATGGCTAAGAATCTGCAGAAAGATGCTCCT
TTAACAGAAGGAGAAAGTTCATTAGTCCTTGAAGCGGAGAGTCACCCTCCTCACAAAGTTGACGAGAATTTGTGGAAGAACCGAGAACAA
CTTGAAGAAATACTTTTCCTATTGGAAAGCTCCAATTGGCCACCAGCGCTTCAATTGCAGTCAACCACTGAAGATGTTGAACTTGTTTCT
GTCCTTGAACGGCTCGGAGAAAAATTCCGAAGTACATTGAAGAGTTTGCAAACTTTCCAGTCAAAGAATTCTGAGTTCGTCTTCAACACT
GTGATGACCTACATGCCACAAGATTTTCGTGGTACACTAATAAGGCAACAGAGGGAGCGTTCTGAGAGAAATAAGCAGGCCGAAGTTGAT
GCTCTAATCAATTCTGGTGGAAGTATTCGTGATCGATATGCTCTGCTATGGAATCAACAAATGGAACGGAGACGGCAACTGGCTCAACTG
GGTTCTGCTACAGGTGTCTATAAGACACTGGTGAAGTATTTAGTTGGAGTGCCACAGGTTCTGTTGGATTTTGTTCAGAAAATAAACGAC
GATGATGGGCCAATGGAAGAGCAGCGACAACGTTATGGTCCACCTTTGTACAGCCTCACAAAAATGGTGCTCAACATTCGGCTTTTTCTT
TCTCTGCTTTGGCGACGTTTTGAAGCTGGAAAACTGTCAAGGAGTCAAATTACGGTCTTGGAAGAAGCAGTAGATATCTACACATCCGAG
TTTCAAAGATTCATCACATTCATTCGAGACGTATTTGCAAATTCCCCTTTCTTTATTACTGCAGAAGAAGCTGGTACATTAGAAGCCAGA
AAAAGTGATGAGTACAAGGAAGTGAGTGTTCCAGCAGGAAAAAGTCATGAGGTATCATTGACAGTCGATGCCATAAATTCATACATTGCG
TGGGATTTCTCTTTGGTTCAAGGCAGAGTAGATATGGACATAGGCTTTAGCATGGAGTATACGGATCCTTCTGGACAGAAGAGCAAATCT
TACCTTATCGACGATATGGAGCTGACCAAGGGAACTTCTGTACGTGCCXTGTCTGGAAACTACAAACTCATATGGGATAATTCTTATTCG
ACATTTTTCAAGAAGGTCTTGCGATTCAAGGTGGACTGTATACCTCCAGTTGTAGAACCAGTGCTTTCATCTGATTAA
Edits in Original Sequence 
(5')TATTATATTGTAGAGTCCTCCTCTGTAAATTCATCTCTTTACCGGCAACACCCCCGTCGGTGTTCCTTTTACGGTaGAACTTCGAA
ATATTCCAAAGAATTATACCTTTTCGCCGACTACCCTTACTTCTCCTCATACACTTGACTGTAGAGTTGCGATCCGTTTTTCAGCTACTA
TTCTTXTTGAGTCTTTGACTGaCTGAACCTTCAGAAAATGGCGTCAACGGAGGGGCTGATGCCAATAACCAGAGCTTTCTTGtCTTCTTA
TTATGATAAATACCCATTTTCCCCTCTTTCTCAAGATGTATCGCGTCTTACTGATGAAATTCATTCCATGGCTAAGAATCTGCAGAAAGA
TGCTCCTTTAACAGAAGGAGAAAGTTCATTAGTCCTTGAAGCGGAGAGTCACCCTCCTCACAAAGTTGACGAGAATTTGTGGAAGAACCG
AGAACAACTTGAAGAAATACTTTTCCTATTGGAAAGCTCCAATTGGCCACCAGCGCTTCAATTGCAGTCAACCACTGAAGATGTTGAACT
TGTTTCTGTCCTTGAACGGCTCGGAGAAAAATTCCGAAGTACATTGAAGAGTTTGCAAACTTTCCAGTCAAAGAATTCTGAGTTCGTCTT
CAACACTGTGATGACCTACATGCCACAAGATTTTCGTGGTACACTAATAAGGCAACAGAGGGAGCGTTCTGAGAGAAATAAGCAGGCCGA
AGTTGATGCTCTAATCAATTCTGGTGGAAGTATTCGTGATCGATATGCTCTGCTATGGAATCAACAAATGGAACGGAGACGGCAACTGGC
TCAACTGGGTTCTGCTACAGGTGTCTATAAGACACTGGTGAAGTATTTAGTTGGAGTGCCACAGGTTCTGTTGGATTTTGTTCAGAAAAT
AAACGACGATGATGGGCCAATGGAAGAGCAGCGACAACGTTATGGTCCACCTTTGTACAGCCTCACAAAAATGGTGCTCAACATTCGGCT
TTTTCTTTCTCTGCTTTGGCGACGTTTTGAAGCTGGAAAACTGTCAAGGAGTCAAATTACGGTCTTGGAAGAAGCAGTAGATATCTACAC
ATCCGAGTTTCAAAGATTCATCACATTCATTCGAGACGTATTTGCAAATTCCCCTTTCTTTATTACTGCAGAAGAAGCTGGTACATTAGA
AGCCAGAAAAAGTGATGAGTACAAGGAAGTGAGTGTTCCAGCAGGAAAAAGTCATGAGGTATCATTGACAGTCGATGCCATAAATTCATA
CATTGCGTGGGATTTCTCTTTGGTTCAAGGCAGAGTAGATATGGACATAGGCTTTAGCATGGAGTATACGGATCCTTCTGGACAGAAGAc
GCAAATCTTACCTTATCGACGATATGGAGCTGACCAAGGGAACTTCTGTACGTGCCXTGTCTGGAAACTACAAACTCATATGGGATAATT
CTTATTCGACATTTTTCAAGAAGGTCTTGCGATTCAAGGTGGACTGTATACCTCCAGTTGTAGAACCAGTGCTTTCATCTGATTAA(3')
GTAGATGAATGAACATACGATGTTCAGATTTGTGACTGCTGCTAATTGTCTATGAAGATGCATTCTCTCATTTGTCTGTATTCACAACAG
TTCTTTTGTTTGTTTTAACTGTAAAAATCCATCCTATGGCTCTGTTAGTCCTGATGCCATGCTGTAACCTGTCTGTTTGTATTGATAAGT
ACCCGGATTTTGATGAAGTTTCAGCATAATAGACCCTCATTATACCTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan