ESTScan Details for Unigene SGN-U564754

Score 
621
Direction 
Forward
Predicted Peptide Sequence 
XXAGXHFHFTKATHTDTLNLQRTELPSLLRLKRSISKPSSGRIVEALEKDEFWQVHQVQGLFXIAVTIGQGKGATSXIVEGKEVEETVGE
EVFGDLXASFEKQNLGVYENKEKCLIFNIIILLKGSVYXAALGEVYNFVKNGVFMEVSVFAEPAPIALILTAIAVSFASAFRALNYGKEM
ERNRDWSEASITLDRSQAXYDPGSELLQLAYDVLFVLFSLKILTVFTAVASASSLYFCLFPYIAQIKSRFGLADPFVSAVVEAIYQDPRP
FDVAVHWHGYSVASLWALDTDNLLGISLCIAFVSHVRLPNIKVCAMLLGCLFVYDIFWVFYSERFFGANVMVSVATQQSSNPVHIVANRL
SLPGLQLITKKLELPVKIVFPRNLLGGVVPGYAAVDFMMLGLGDMAIPSMLLALVLCFDHRKSKDSGSIMDIPPPKEDISSPKGFYIWYA
LAGYSVGLVTALAAGXFDSLATTSTSILGTINFGADNCHFMDEKGAAELWEGSPSNINEKTRFTEAELLHSSHKATSREGTSKPVNLLSI
FQPHLLDIYNFCWSYXLAYIYEAVNLEXSDKPQTYVAITNANISITGVALFYSSPYPGDFKV
Predicted Coding Sequence 
XTNNNGGCCGGGNNTCACTTTCATTTCACTAAAGCAACTCACACTGATACACTGAATCTCCAGAGAACAGAATTGCCTTCTCTTCTCCGG
TTGAAACGTTCGATAAGCAAACCCTCATCAGGCCGGATCGTTGAGGCGTTGGAGAAAGACGAGTTCTGGCAAGTTCATCAAGTCCAAGGT
TTATTTGAXATTGCGGTGACGATTGGTCAAGGTAAAGGAGCAACTTCTXATATAGTGGAAGGGAAGGAAGTAGAGGAAACAGTAGGTGAA
GAGGTGTTTGGAGACCTTAXAGCATCTTTTGAAAAGCAAAATCTGGGAGTTTATGAAAATAAGGAGAAGTGTTTGATTTTTAACATTATT
ATACTTCTGAAAGGAAGTGTTTATAXGGCAGCACTAGGAGAAGTGTACAACTTTGTTAAGAATGGAGTCTTTATGGAAGTTAGTGTATTT
GCTGAACCAGCACCCATCGCTCTTATTCTGACTGCCATAGCTGTGTCATTTGCATCTGCCTTCCGGGCTTTAAATTATGGCAAAGAAATG
GAGAGAAATCGTGATTGGTCTGAAGCATCAATTACCTTAGACAGGTCTCAGGCTXCTTATGATCCCGGTAGTGAGCTCTTGCAGCTTGCT
TATGATGTTCTATTTGTTCTCTTCAGTCTCAAGATCCTCACTGTGTTCACTGCAGTTGCCTCAGCATCTTCTCTTTACTTTTGCCTTTTC
CCTTATATTGCCCAAATCAAGTCTCGATTTGGCTTAGCTGATCCCTTCGTATCTGCTGTTGTTGAAGCCATTTACCAGGATCCAAGGCCT
TTTGACGTTGCTGTGCATTGGCACGGTTATAGCGTGGCTTCTCTCTGGGCATTGGATACTGATAATTTGCTGGGCATCTCTCTTTGTATT
GCGTTTGTGAGCCATGTTCGCCTTCCTAACATTAAGGTTTGTGCAATGCTCCTTGGCTGCTTGTTTGTATATGATATATTCTGGGTTTTC
TATTCCGAGAGATTCTTTGGTGCAAATGTCATGGTGTCTGTAGCAACCCAGCAATCATCGAATCCTGTACACATAGTGGCGAATAGATTG
AGCCTTCCTGGATTGCAGTTGATAACCAAAAAACTCGAGTTGCCTGTCAAGATTGTGTTCCCTAGAAACTTACTGGGTGGTGTAGTGCCT
GGATATGCTGCTGTTGATTTCATGATGCTGGGTCTTGGCGACATGGCTATTCCTTCTATGCTTTTAGCATTGGTTCTCTGTTTTGACCAT
AGAAAGAGCAAGGACTCTGGAAGCATCATGGATATACCACCTCCAAAGGAGGATATATCATCTCCAAAGGGGTTTTACATCTGGTATGCG
CTAGCAGGATATTCCGTTGGACTGGTTACTGCCTTAGCAGCTGGTXATTTTGACTCACTCGCCACAACCAGCACTTCTATACTTGGTACC
ATCAACTTTGGGGCCGATAATTGTCATTTCATGGATGAGAAAGGAGCTGCTGAGCTGTGGGAAGGATCACCGTCAAACATAAATGAGAAA
ACTCGTTTTACTGAAGCTGAGCTCTTGCATTCTTCCCATAAAGCTACATCTAGGGAGGGCACATCCAAACCTGTAAATTTACTTAGTATA
TTTCAGCCCCATCTGTTGGATATTTACAATTTTTGTTGGAGCTATGXTCTTGCGTATATTTACGAGGCTGTCAATCTTGAGXACAGCGAC
AAGCCTCAGACTTATGTTGCAATTACAAACGCTAATATTTCTATTACTGGAGTTGCATTGTTTTATTCCTCCCCTTACCCCGGTGATTTC
AAGGTX
Edits in Original Sequence 
(5')XTNNNGGCCGGGNNTCACTTTCATTTCACTAAAGCAACTCACACTGATACACTGAATCTCCAGAGAACAGAATTGCCTTCTCTTCT
CCGGTTGAAACGTTCGATAAGCAAACCCTCATCAGGCCGGATCGTTGAGGCGTTGGAGAAAGACGAGTTCTGGCAAGTTCATCAAGTCCA
AGGTTTATTTGAXATTGCGGTGACGATTGGTCAAGGTAAAGGAGCAACTTCTXATATAGTGGAAGGGAAGGAAGTAGAGGAAACAGTAGG
TGAAcGAGGTGTTTGGAGACCTTAXAGCATCTTTTGAAAAGCAAAATCTGGGAGTTTATGAAAATAAGGAGAAGTGTTTGATTTTTAACA
TTATTATACTTCTGAAAGGAAGTGTTTATAXGGCAGCACTAGGAGAAGTGTACAACTTTGTTAAGAATGGAGTCTTTATGGAAGTTAGTG
TATTTGCtTGAACCAGCACCCATCGCTCTTATTCTGACTGCCATAGCTGTGTCATTTGCATCTGCCTTCCGGGCTTTAAATTATGGCAAA
GAAATGGAGAGAAATCGTGATTGGTCTGAAGCATCAATTACCTTAGACAGGTCTCAGGCTXCTTATGATCCCGGTAGTGAGCTCTTGCAG
CTTGCTTATGATGTTCTATTTGTTCTCTTCAGTCTCAcAGATCCTCACTGTGTTCACTGCAGTTGCCTCAGCATCTTCTCTTTACTTTTG
CCTTTTCCCTTATATTGCCCAAATCAAGTCTCGATTTGGCTTAGCTGATCCCTTCGTATCTcGCTGTTGTTcGAAGCCATTTACCAGGAT
CCAAGGCCTTTTGACGTTGCTGTGCATTGGCACGGTTATAGCGTGGCTTCTCTCTGGGCATTGGATACTGaATAATTTGCTGGGCATCTC
TCTTTGTATTGCGTTTGTGAGCCATGTTCGCCTTCCTAACATTAAGGTTTGTGCAATGCTCCTTGGCTGCTTGTTTGTATATGATATATT
CTGGGTTTTCTATTCCGAGAGATTCTTTGGTGCAAATGTCATGGTGTCTGTAGCAACCCAGCAATCATCGAATCCTGTACACATAGTGGC
GAATAGATTGAGCCTTCCTGGATTGCAGTTGATAACCAAAAAACTCGAGTTGCCTGTCAAGATTGTGTTCCCTAGAAACTTACTGGGTGG
TGTAGTGCCTGGATATGCTGCTGTTGATTTCATGATGCTGGGTCTTGGCGACATGGCTATTCCTTCTATGCTTTTAGCATTGGTTCTCTG
TTTTGACCATAGAAAGAGCAAGGACTCTGGAAGCATCATGGATATACCACCTCCAAAGGAGGATATATCATCTCCAAAGGGGTTTTACAT
CTGGTATGCGCTAGCAGGATATTCCGTTGGACTGGTTACTGCCTTAGCAGCTGGTXATTTTGACTCACTCGCCACAACCAGCACTTCTAT
ACTTGGTACCATCAACTTTGGGGCCGATAATTGTCATTTCATGGATGAGAAAGGAGCTaGCTGAGCTGTGGGAAGGATCACCGTCAAACA
TAAATGAGAAAACTCGTTTTACTGAAGtCTGAGCTCTTGCATTCTTCCCATAAAGCTACATCTAGGGAGGGCACATCCAAACCTGTAAAT
TTACTTAGTATATTTCAGCCCCATCTGTTGGATATTTACAATTTTTGTTGGAGCTATGXTCTTGCGTATATTTACGAGGCTGTCAATCTT
GAGXACAGCGACAAGCCTCAGACTTATGTTGCAATTACAAACGCTAATATTTCTATTACTGGAGTTGCATTGTcTTTATTCCTCCCCTTA
CCCCGGTGATTTCAAGGTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan