ESTScan Details for Unigene SGN-U564797

Score 
88
Direction 
Reverse
Predicted Peptide Sequence 
XFGFATIIDNPLPIVAALTFWAVGLDGGASGFLFYFSVVLASIWAGNSFVTFLSSVVPHVMIGYTIELHYSDTSSSSVGFYMNRDRIPSY
WIWFHYLSLVKYPYEAVLLNEFKDPTKCFVRGVQLFDXQPIGGFTEFNKGEIIGQYKRNIERNDNKFHLFHEWRRYIGATRDNSTEQMDL
FVGNNCMGIFL*
Predicted Coding Sequence 
XGCTTTGGTTTCGCTACCATCATTGATAATCCTCTCCCTATCGTTGCAGCCCTGACTTTCTGGGCTGTTGGCCTAGACGGTGGAGCTTCG
GGCTTTTTGTTCTACTTCTCTGTCGTTCTAGCTTCAATCTGGGCGGGGAATTCATTCGTCACTTTCCTCTCTAGTGTCGTTCCTCATGTC
ATGATCGGTTACACAATCGAGTTGCATTACTCGGATACTTCCTCCTCTTCAGTGGGATTCTACATGAATCGCGATAGGATCCCATCGTAC
TGGATATGGTTTCATTACCTCTCCCTCGTGAAATACCCATATGAAGCAGTGTTGCTGAACGAATTCAAAGACCCCACGAAATGCTTTGTT
CGTGGGGTTCAGTTGTTCGATAAXCAGCCAATTGGGGGATTTACCGAATTCAATAAAGGAGAAATTATTGGACAATATAAGCGAAACATT
GAACGTAACGATAACAAGTTCCACTTGTTTCACGAGTGGCGCAGATATATTGGTGCAACAAGGGATAACTCAACTGAACAAATGGATTTG
TTTGTGGGTAACAATTGCATGGGGATTTTCCTATAG
Edits in Original Sequence 
(5')XGCTTTGGTTTCGCTACCATCATTGATAATCCTCTCCCTATCGTTcGCAGCCCTGACTTTCTGGGCTGTTGGCCTAGACGGTGGAG
CTTCGGGCTTTTTGTTCTACTTCTCTGTCGTTCTAGCTTCAATCTGGGCGGGGAATTCATTCGTCACTTTCCTCTCTAGTGTCGTTCCTC
ATGTCATGATCGGTTACACAATCGtAGTTGCATTACTCGGATACTTCCTCCTCTTCAGTGGGATTCTACATGAATCGCGATAGGATCCCA
TCGTACTGGATATGGTTTCATTACCTCTCCCTCGTGAAATACCCATATGAAGCAGTGTTGCTGAACGAATTCAAAGACCCCACGAAATGC
TTTGTTCGTGGGGTTCAGTTGTTCGATAAXCAGCCAATTGGGGGATTTACCGAATTCAATAAAGGAGAAATTATTGGACAATATAAGCGA
AACATTGAACGTAACGATAACAAGTTCCACTTGTTTCACGAGTGGCGCAGATATATTGGTGCAACAAGGGATAACTCAACTGAACAAATG
GATTTGTTTGTGGGTAACAATTGCATGGGGATTTTCCTATAG(3')GATTTTATTTTATTTCACTTTGTTATTGGGAAGTAAAAATAAAA
GGAGGTAATAAATAAGCTAGACATAATATTATAATAATGTATTCGAAGATACTTTTGAATATTGTATTTTCACGAATTTTATCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan