Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U564868

Score 
609
Direction 
Forward
Predicted Peptide Sequence 
MGNANAREDGAAGDGDGDGQVSGRRSNVESGIVEDHHALNSRVPSADLMVNSPPQSPHRSASPLLFGPQVPVVPLQGGDGNPVSNQMWGN
ECEDASDHSLEGGIPTLITWSYGGNNVAIQGSWDNWTSRKILQRSGKDYTVLLVLPSGIYHYKFIVDGEVRYIPELPCVADETGVVFNLL
DVNDNVPENLESVAEFEAPPSPDSSYAQALMGEEDFEKEPVAVPPQLHLTVLGSENSEEAPSSPKPQHVVLNHLFIEKGWASQSIVALGL
THRFQSKYVTVVXLQATEEVTTPVYNQIFLELSQCGCFKISTVYRPAQCSNFL*
Predicted Coding Sequence 
ATGGGGAATGCGAACGCCAGAGAAGACGGCGCCGCCGGAGACGGCGACGGCGACGGTCAGGTATCGGGAAGAAGATCTAATGTTGAATCT
GGAATAGTAGAAGATCACCACGCTCTGAACTCGCGAGTGCCTTCGGCTGACTTGATGGTCAATTCTCCTCCGCAGAGTCCACATCGTTCA
GCTTCACCTCTCTTGTTCGGACCTCAGGTGCCAGTAGTTCCTTTACAAGGAGGGGATGGCAATCCTGTTAGCAATCAAATGTGGGGCAAT
GAATGCGAGGATGCCTCTGATCATTCACTAGAGGGCGGCATACCTACTTTGATAACATGGAGTTATGGTGGTAATAACGTTGCTATCCAA
GGATCTTGGGACAACTGGACATCAAGGAAAATTCTCCAAAGATCAGGCAAGGACTATACCGTTCTTTTGGTCCTTCCATCGGGTATATAT
CATTACAAATTCATTGTGGATGGGGAAGTTAGATATATTCCAGAACTTCCATGTGTAGCAGATGAGACAGGCGTTGTCTTTAATCTTCTT
GATGTTAATGACAATGTTCCAGAGAACCTCGAAAGTGTTGCAGAGTTTGAGGCCCCACCATCACCTGACTCTAGCTATGCGCAAGCTTTG
ATGGGAGAGGAGGATTTTGAAAAGGAGCCAGTGGCAGTTCCACCGCAACTTCATCTAACTGTTCTTGGTTCTGAAAACTCAGAAGAAGCA
CCTTCTTCTCCAAAACCCCAGCACGTAGTACTTAATCACCTCTTTATAGAGAAAGGATGGGCTTCTCAATCCATTGTTGCTCTTGGTTTA
ACGCATAGATTCCAGTCCAAATATGTCACAGTTGTTXCTCTACAAGCCACTGAAGAGGTGACCACTCCTGTTTACAATCAAATCTTTCTA
GAGCTTTCTCAGTGTGGCTGCTTTAAGATTTCCACTGTTTATAGACCTGCTCAATGTTCAAACTTCCTTTAA
Edits in Original Sequence 
GCATACAAAATATACATATGTATATTCACTAGCATTATTGGGAAGAC(5')ATGGGGAATGCGAACGCCAGAGAAGACGGCGCCGCCGGA
GACGGCGACGGCGACGGTCAGGTATCGGGAAGAAGATCTAATGTTGAATCTGGAATAGTAGAAGATCACCACGCTCTGAACTCGCGAGTG
CCTTCGGCTGACTTGATGGTCAATTCTCCTCCGCAGAGTCCACATCGTTCAGCTTCACCTCTCTTGTTCGGACCTCAGGTGCCAGTAGTT
CCTTTACAAGGAGGGGATGGCAATCCTGTTAGCAATCAAATGTGGGGCAATGAATGCGAGGATGCCTCTGATCATTCACTAGAGGGCGGC
ATACCTACTTTGATAACATGGAGTTATGGTGGTAATAACGTTGCTATCCAAGGATCTTGGGACAACTGGACATCAAGGAAAATTCTCCAA
AGATCAGGCAAGGACTATACCGTTCTTTTGGTCCTTCCATCGGGTATATATCATTACAAATTCATTGTGGATGGGGAAGTTAGATATATT
CCAGAACTTCCATGTGTAGCAGATGAGACAGGCGTTGTCTTTAATCTTCTTGATGTTAATGACAATGTTCCAGAGAACCTCGAAAGTGTT
GCAGAGTTTGAGGCCCCACCATCACCTGACTCTAGCTATGCGCAAGCTTTGATGGGAGAGGAGGATTTTGAAAAGGAGCCAGTGGCAGTT
CCACCGCAACTTCATCTAACTGTTCTTGGTTCTGAAAACTCAGAAGAAGCACCTTCTTCTCCAAAACCCCAGCACGTAGTACTTAATCAC
CTCTTTATAGAGAAAGGATGGGCTTCTCAATCCATTGTTGCTCTTGGTTTAACGCATAGATTCCAGTCCAAATATGTCACAGTTGTTXCT
CTACAAGCCACTGAAGAGGTGACCACTCCgTGTTTACAATCAAATCTTTCTAGAGCTTTCTCAGTGTGGCTGCTTTAAGATTTCCACTGT
TTATAGACCTGCTCAATGTTCAAACTTCCTTTAA(3')CCTCTCCTCTGTTGTACAATAGACCAATGCATTTTCTCGTTTCTTCCCCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan