ESTScan Details for Unigene SGN-U564905

Score 
1086
Direction 
Forward
Predicted Peptide Sequence 
RVKISPLCALLNYAPYTDTTSLSLRHRINAAENFPAMGVSFKVSKTGARFRPKPVHPDIEEHDDVALRANKERNSVLPQNKSNSASTGRL
TGAVVHGSKDVTTVPDNEVSFTLCLFLDGYSIGKPSEMQNEYGHQAPENVPKLLHPYDRASETLFSAIESGHLPGDILEDIPCKYVDGTL
VCEVRDYRKCFPEVGQNAPSTTGCPIINRVCLKMSLENVVKDIPLISDSAWTYGDMMEXRIPDIKSPTTTTLLRPRPKVRKPLQQQSFLK
VDIGYRQSKEEKTEELPDVIVMSNDKIHGKNICIDRVPESSRSGDTGQLLPQPAHENLNRQNNGPTNMLALRSNSFGSETSIPASPSVSQ
QPKYPMGVVSPRIMQDHRSGVLNASVASPAAPEMMLSYADAMSSGAASLHGKRENHDGQASSLSNLNKRARFTHMSADSNQQQLIGGQID
GSHAPDLHWKNSLLQQHSVPRGIPYANTNMQKYPQQIFEGGLNQEAGTMPFTGQQGIKYNLKEEPAEIERLDKLEPGRTKNXDADGGIGY
EPYGIPAGPTKAENDAAVYAVGFPQTPWNGLGQPLENNLRKEDPFQNRKIVQSPRVSAGGLPQSPLSSKSGEFSNGSVGAQYGAAVTSGL
IQSMKEKQGSTSVAPAGGTTSMTSSANDSMQRQHQAQIAARRRSNSVPKTPMMSGVGSPASVSTMSLPINASSPPVGSTHSADQIILERF
SKIEMLTTRFQLYP
Predicted Coding Sequence 
AGAGTCAAAATTTCTCCTCTCTGTGCTCTGCTTAATTATGCCCCATACACAGATACTACTTCACTAAGTCTCCGGCACCGGATCAACGCT
GCTGAGAATTTTCCGGCAATGGGGGTTTCGTTTAAGGTTTCCAAAACCGGTGCAAGGTTTCGGCCCAAACCAGTACATCCCGACATCGAA
GAACATGACGACGTCGCTCTTCGAGCTAACAAAGAAAGGAATTCAGTTCTTCCACAAAATAAATCCAATTCCGCATCGACTGGAAGGCTC
ACGGGTGCGGTTGTTCATGGAAGCAAGGATGTTACCACAGTACCTGATAATGAAGTTTCCTTCACATTGTGCCTTTTCCTGGATGGATAT
TCTATTGGGAAGCCCTCTGAGATGCAGAATGAATATGGGCATCAAGCCCCTGAAAATGTTCCGAAATTATTGCATCCATATGATAGAGCA
TCTGAAACTCTCTTTTCAGCAATTGAGTCTGGACATCTGCCAGGCGATATTTTGGAGGATATACCTTGCAAATATGTTGACGGAACTCTA
GTCTGCGAGGTGCGAGATTATCGGAAGTGCTTCCCTGAAGTTGGACAAAATGCGCCTTCAACCACTGGTTGTCCCATTATTAACAGAGTA
TGTCTAAAAATGTCTCTTGAAAATGTGGTGAAGGACATTCCATTGATTTCAGATAGTGCTTGGACATACGGTGATATGATGGAAGXTCGA
ATCCCGGATATTAAGAGCCCTACAACCACAACTCTGCTTAGACCCCGCCCCAAAGTTAGAAAGCCTCTGCAACAACAAAGCTTCCTCAAA
GTTGACATTGGGTATAGGCAATCTAAGGAGGAAAAGACTGAGGAGCTTCCAGATGTGATTGTCATGTCTAATGATAAGATCCATGGAAAA
AATATTTGCATAGATAGAGTGCCAGAAAGTTCAAGGTCAGGAGATACTGGACAGCTTCTGCCGCAGCCTGCTCATGAGAATCTGAACCGA
CAAAATAATGGACCAACCAATATGTTGGCACTAAGAAGTAACAGTTTTGGGTCTGAGACCTCTATTCCAGCATCGCCTTCGGTATCTCAG
CAACCAAAGTATCCAATGGGGGTTGTGAGTCCAAGAATCATGCAGGACCATAGGTCAGGAGTTTTAAATGCATCAGTAGCTTCTCCTGCT
GCGCCAGAAATGATGCTTTCATATGCGGATGCGATGAGCTCTGGTGCTGCTTCTTTACATGGTAAGAGAGAGAATCATGATGGCCAAGCA
TCTTCCCTGTCCAATTTAAACAAGAGGGCAAGGTTTACACATATGAGTGCTGATTCCAATCAACAGCAACTTATAGGAGGACAAATAGAT
GGCTCTCATGCTCCAGATTTGCACTGGAAAAATTCCTTATTACAGCAACATTCAGTTCCCAGGGGAATTCCATATGCTAATACAAACATG
CAAAAGTATCCTCAACAAATTTTTGAAGGGGGTCTGAACCAGGAAGCTGGAACAATGCCATTCACAGGACAGCAAGGAATAAAGTATAAC
TTAAAGGAAGAGCCTGCTGAGATAGAGAGATTGGACAAATTAGAGCCAGGAAGGACTAAAAATGAXGATGCAGATGGTGGAATCGGATAT
GAACCTTATGGAATCCCAGCAGGCCCGACTAAAGCAGAGAATGACGCAGCAGTTTACGCGGTTGGTTTTCCTCAGACACCCTGGAATGGC
CTTGGTCAGCCTCTTGAAAACAATCTTCGGAAAGAAGACCCATTCCAGAACAGGAAAATAGTGCAAAGTCCTCGTGTATCTGCAGGAGGC
TTGCCTCAATCTCCTTTATCCTCTAAGTCTGGAGAGTTTTCTAATGGTTCTGTAGGAGCTCAATACGGTGCAGCTGTGACTAGTGGACTT
ATACAATCAATGAAGGAGAAGCAAGGATCCACATCTGTTGCTCCAGCTGGTGGAACAACTTCTATGACTTCTAGCGCCAATGATTCCATG
CAGCGGCAACACCAGGCTCAAATTGCTGCAAGGCGGAGATCCAATTCTGTTCCTAAGACCCCCATGATGAGCGGAGTTGGTTCTCCTGCC
AGTGTCAGTACCATGAGTCTTCCAATAAATGCAAGCAGTCCTCCCGTAGGATCTACACACTCAGCTGACCAAATCATACTTGAAAGGTTC
TCCAAAATTGAAATGCTGACAACTAGGTTTCAACTTTATCCC
Edits in Original Sequence 
(5')AGAGTCAAAATTTCTCCTCTCTGTGCTCTGCTTAATTATGCCCCATACACAGATACTACTTCACTAAGTCTCCGGCACCGGATCAA
CGCTGCTGtAGAATTTTCCGGCAATGGGGGTTTCGTTTAAGGTTTCCAAAACCGGTGCAAGGTTTCGGCCCAAACCAGTACATCCCGACA
TCGAAGAACATGACGACGTCGCTCTTCGAGCTAACAAAGAAAGGAATTCAGTTCTTCCACAAAATAAATCCAATTCCGCATCGACTGGAA
GGCTCACGGGTGCGGTTGTTCATGGAAGCAAGGATGTTACCACAGTACCTGATAATGAAGTTTCCTTCACATTGTGCCTTTTCCTGGATG
GATATTCTATTGGGAAGCCCTCTGAGATGCAGAATGAATATGGGCATCAAGCCCCTGAAAATGTTCCGAAATTATTGCATCCATATGATA
GAGCATCTGAAACTCTCTTTTCAGCAATTGAGTCTGGACATCTGCCAGGCGATATTTTGGAGGATATACCTTGCAAATATGTTGACGGAA
CTCTAGTCTGCGAGGTGCGAGATTATCGGAAGTGCTTCCCTGAAGTTGGACAAAATGCGCCTTCAACCACTGGTTGTCCCATTATTAACA
GAGTATGTCTAAAAATGTCTCTTGAAAATGTGGTGAAGGACATTCCATTGATTTCAGATAGTGCTTGGACATACGGTGATATGATGGAAG
XTCGAATCCCGGATATTAAGAGCCCTACAACCACAACTCTGCTTAGACCCCGCCCCAAAGTTAGAAAGCCTCTGCAACAACAAAGCTTCC
TCAAAGTTGACATTGGGTATAGGCAATCTAAGGAGGAAAAGACTGAGGcAGCTTCCAGATGTGATTGTCATGTCTAATGATAAGATCCAT
GGAAAAAATATTTGCATAGATAGAGTGCCAGAAAGTTCAAGGTCAGGAGATACTGGACAGCTTCTGCCGCAGCCTGCTCATGAGAATCTG
AACCGACAAAATAATGGACCAACCAATATGTTGGCACTAAGAAGTAACAGTTTTGGGTCTGAGACCTCTATTCCAGCATCGCCTTCGGTA
TCTCAGCAACCAAAGTATCCAATGGGGGTTGTGAGTCCAAGAATCATGCAGGACCATAGGTCAGGAGTTTTAAATGCATCAGTAGCTTCT
CCTGCTGCGCCAGAAATGATGCTTTCATATGCGGATGCGATGAGCTCTGGTGCTGCTTCTTTACATGGTAAGAGAGAGAATCATGATGGC
CAAGCATCTTCCCTGTCCAATTTAAACAAGAGGGCAAGGTTTACACATATGAGTGCTGATTCCAATCAACAGCAACTTATAGGAGGACAA
ATAGATGGCTCTCATGCTCCAGATTTGCACTGGAAAAATTCCTTATTACAGCAACATTCAGTTCCCAGGGGAATTCCATATGCTAATACA
AACATGCAAAAGTATCCTCAACAAATTTTTGAAGGGGGTCTGAACCAGGAAGCTGGAACAATGCCATTCACAGGACAGCAAGGAATAAAG
TATAACTTAAAGGAAGAGCCTGCTGAGATAGAGAGATTGGACAAATTAGAGCCAGGAAGGACTAAAAATGAXGATGCAGATGGTGGAATC
GGATATGAACCTTATGGAATCCCAGCAGGCCCGACTAAAGCAGAGAATGACGCAGCAGTTTACGCGGTcTGGTTTTCCTCAGACACCCTG
GAATGGCCTTGGTCAGCCTCTTGAAAACAATCTTCGGAAAGAAGACCCATTCCAGAACAGGAAAATAGTGCAAAGTCCTCGTGTATCTGC
AGGAGGCTTGCCTCAATCTCCTTTATCCTCTAAGTCTGGAGAGTTTTCTAATGGTTCTGTAGGAGCTCAATACGGTGCAGCTGTGACTAG
TGGACTTATACAATCAATGAAGGAGAAGCAAGGATCCACATCTGTTGCTCCAGCTGGTGGAACAACTTCTATGACTTCTAGCGCCAATGA
TTCCATGCAGCGGCAACACCAGGCTCAAATTGCTGCAAGGCGGAGATCCAATTCTGTTCCTAAGACCCCCATGATGAGCGGAGTTGGTTC
TCCTGCCAGTGTCAGTACCATGAGTCTTCCAATAAATGCAAGCAGTCCTCCCGTAGGATCTACACACTCAGCTGACCAAATCATACTTGA
AAGGTTCTCCAAAATTGAAATGCTGACAACTAGGTTTCAACTTTATCCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan