ESTScan Details for Unigene SGN-U565180

Score 
139
Direction 
Forward
Predicted Peptide Sequence 
SPNDAIFXNKILFSDFKVXEDKKAKYVLLQQTDFIALDPRVRSIEKFINNGCEFLLFHFHHLFIIDAALIISGDATGGDFDVSGWIPMKS
ADSCEGSIAECMAAGEFEMDSESNRRILATTDYISYGALQSNSVPCSRRGASYYNCKTGAEANPYTRGCSAITRCRS*
Predicted Coding Sequence 
TCACCAAACGATGCCATTTTTXTAAACAAGATATTGTTTTCTGATTTCAAAGTAGAXGAGGACAAGAAAGCCAAATATGTTTTGTTACAA
CAAACCGACTTTATAGCCCTCGACCCACGCGTCCGCAGCATTGAAAAATTTATCAACAATGGCTGCGAATTCCTTTTGTTCCATTTTCAT
CATCTCTTCATTATTGATGCAGCTTTGATCATCTCCGGCGATGCTACCGGCGGCGATTTCGACGTGAGCGGTTGGATTCCGATGAAATCC
GCCGATAGCTGTGAAGGTTCGATAGCGGAGTGTATGGCTGCCGGAGAATTCGAAATGGATTCGGAGAGCAACAGGCGTATATTAGCAACT
ACTGATTATATAAGCTATGGTGCGCTGCAGAGTAACAGTGTTCCGTGTTCTAGAAGAGGTGCGTCGTATTATAACTGCAAAACAGGTGCT
GAAGCTAATCCGTATACACGTGGTTGCAGTGCTATTACTCGTTGCCGGAGTTAA
Edits in Original Sequence 
(5')TCACCAAACGATGCCATTTTTXTAAACAAGATATTGTTTTCTGATTTCAAAGTAGAXGAGGACAAGAAAGCCAAATATGTTTTGTT
ACAACAAACCGACTTTATAGCCCTCGACCCACGCGTCCGCAGCATTGAAAAATTTATCAACAATGGCTGCGAATTCCTTTTGTTCCATTT
TCATCATCTCTTCATTATTGATcGCAGCTTTGATCATCTCCGGCGATGCTACCGGCGGCGATTTCGACGTGAGCGGTTGGATTCCGATGA
AATCCGCCGATAGCTGTGAAGGTTCGATAGCGGAGTGTATGGCTGCCGGAGAATTCGAAATGGATTCGGAGAGCAACAGGCGTATATTAG
CAACTACTGATTATATAAGCTATGGTGCGCTGCAGAGTAACAGTGTTCCGTGTTCTAGAAGAGGTGCGTCGTATTATAACTGCAAAACAG
GTGCTGAAGCTAATCCGTATACACGTGGTTGCAGTGCTATTACTCGTTGCCGGAGTTAA(3')ATTAATTAAAGATCGAATTAATCGATG
TTAATTAATTATTAGTAAGTGTAATTGTTTTGAATAATTTCGTAGTGTTTATATTGTATACTTTAAGTAGGAGTATTTTTCTTTTCAGTT
GCAATTTCAAATAAAGTGACAGTGGTGCTTTGGCAGTGGTTTATGGTTAATACAATGTTCATTTGGTGTTTGTTAATACATGTATTATTC
TCTAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan