ESTScan Details for Unigene SGN-U565201

Score 
292
Direction 
Forward
Predicted Peptide Sequence 
XGKLSFNIFSSYQIIFYNKDRRLPVHRRVVFASSSSSSSSTTPCQIKSTSKNGLKVFEDKSTGVVCYRDEYGEITCEGYDEGPRFCHQPP
KSPSKSRDEEIVELLQRNWFHIADVAVE*
Predicted Coding Sequence 
XXGGGTAAACTCTCTTTCAACATCTTTTCTAGTTACCAAATCATCTTTTACAACAAGGACAGAAGATTGCCTGTCCATAGACGAGTAGTG
TTTGCATCATCATCATCATCGTCATCGTCAACAACTCCATGTCAGATCAAATCAACTTCGAAAAATGGGCTTAAGGTATTTGAAGATAAG
TCAACGGGTGTAGTTTGTTATAGAGATGAATATGGAGAAATCACATGTGAAGGATATGATGAAGGCCCTCGTTTTTGTCACCAACCCCCA
AAGTCTCCTTCTAAATCAAGAGATGAAGAGATTGTAGAGCTCCTCCAAAGAAATTGGTTTCATATAGCTGATGTTGCTGTGGAATGA
Edits in Original Sequence 
(5')XXGGGTAAACTCTCTTTCAACATCTTTTCTAGTTACCAAATCATCTTTTACAACAAGGACAGtAAGATTGCCTGTCCATAGACGAG
TAGTGTTTGCATCATCATCATCATCGTCATCGTCAACAACTCCATGTCAGATCAAATCAACTTCGAAAAATGGGCTTAAGGTATTTGAAG
ATAAGTCAACGGGTGTAGTTTGTTATAGAGATGAATATGGAGAAATCACATGTGAAGGATATGATGAAGGCCCTCGTTTTTGTCACCAAC
CCCCAAAGTCTCCTTCTAAATCAAGAGATGAAGAGATTGTAGAGCTCCTCCAAAGAAATTGGTTTCATATAGCTGATGTTGCTGTGGAAT
GA(3')AGAGATTTTGTGCATTCTTAACGGGTTAAATCAACTCGATTATATATATGCTTCAACTTTAAGCTAATTAGATATTGTTACTCG
AATATTATGTATCCGTTCTGTTCTATTCAAACTCATGATAGTTGTCGTTATTCTAATAGCTAGTATAATTTCACAAAAAAATGAGGGGTA
TTGGCTTGCTTTTTTTTTTCTTTATTAATTAAAATGTATATAAGTAGTACAACTTGTGTATTAACAATTTATTTTTCACTTTCAACCTAA
TGTTTTGCTTCCAATCCTCACAATTTGTATATATAAGAATGGATTTTACTGTTTAGTGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan