Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U565313

Score 
1062
Direction 
Forward
Predicted Peptide Sequence 
XLSLCLASSSSHANILGQPXLLLIPLGWLNVWYRGYYLATSRELTRLDSITKAPVIHHFSESISCVMTIRCFRKQEMFSQENVNRVDANL
RMDFHNNGSNEWLGFRLELLGSLLLCVSAMFMIILPSSIIKPENVGLSISYGLSLNSVLFWSVFVSCFVENKMVSVERLKQFSCIPSEAE
WRKRDFVPPSDWPNHGNVELEDLQVRYRPNTPLVLKGITLNIRGGEKIGVVGRTGGGKSTLIQVFFRLVEPAAGRIVIDGIDISRLGLHD
LRSRFGIIPQEPVLFEGTVRSNIDPIGQYSDDEIWKSLDRCQLKEVVSSKPEKLDSPVVDNGDNWSVGQRQLLCLGRVMLKRSRLLFMDE
ATASVDSQTDAVIQKIIREDFNACTIISIAHRIPTVMDCDRVLVVDAGIAKEFDKPSHLLERPSLFGALVQEYANRSSEL*
Predicted Coding Sequence 
XGTTTGTCACTCTGCTTGGCATCATCATCATCACATGCCAATATTCTTGGCCAACCAXCACTACTTTTGATTCCTCTAGGCTGGCTAAAT
GTTTGGTACCGGGGATATTATCTTGCAACATCTCGTGAATTGACTCGGCTTGACTCAATTACAAAAGCACCCGTTATTCATCATTTCTCT
GAAAGCATCTCATGTGTTATGACTATACGCTGCTTTAGGAAGCAGGAGATGTTTAGTCAAGAAAACGTTAACCGAGTTGATGCCAATCTG
CGAATGGATTTCCACAACAATGGATCCAATGAGTGGTTGGGATTTCGACTGGAACTGCTTGGAAGCTTGCTTCTCTGTGTTTCTGCAATG
TTCATGATTATCTTACCTAGCAGCATCATCAAGCCAGAGAATGTTGGCTTATCGATATCATATGGTTTGTCCCTTAACAGTGTGCTATTC
TGGTCCGTCTTTGTGAGTTGCTTCGTGGAAAACAAAATGGTTTCTGTTGAAAGATTAAAACAGTTCTCATGCATACCATCAGAAGCTGAG
TGGCGAAAAAGGGATTTTGTCCCACCTTCAGATTGGCCGAACCATGGCAATGTTGAGCTTGAAGACTTACAAGTTAGGTATCGTCCAAAT
ACTCCTCTAGTGCTTAAAGGAATTACTCTCAACATTAGAGGGGGAGAGAAGATCGGTGTTGTTGGTCGTACTGGAGGTGGAAAATCAACA
CTTATTCAAGTTTTCTTCCGTTTGGTGGAGCCTGCAGCTGGAAGAATAGTCATTGACGGCATTGACATATCCAGGCTCGGGCTTCATGAT
CTTAGATCTCGCTTTGGGATCATTCCTCAAGAACCAGTTCTTTTTGAAGGAACTGTGAGAAGCAACATTGACCCCATTGGACAATATTCA
GATGATGAAATTTGGAAGAGCCTCGATCGCTGCCAACTGAAAGAAGTGGTGTCTTCAAAACCCGAAAAGCTTGACTCACCAGTTGTTGAT
AATGGAGACAACTGGAGTGTTGGGCAGAGGCAGCTTCTTTGCTTAGGAAGAGTGATGCTAAAACGAAGCAGACTTCTATTTATGGACGAG
GCAACCGCCTCTGTTGATTCACAGACAGATGCTGTGATTCAGAAAATCATCCGCGAGGACTTCAACGCCTGTACTATAATCAGCATTGCC
CACAGAATACCAACAGTCATGGACTGTGATAGAGTTCTTGTTGTAGATGCAGGAATAGCAAAAGAGTTTGACAAACCATCTCATTTGCTG
GAAAGGCCTTCACTTTTTGGGGCTTTGGTTCAAGAATATGCCAACAGATCATCTGAGCTCTAA
Edits in Original Sequence 
(5')XGTTTGTCACTCTGCTTGGCATCATCATCATCACATGCCAATATTCTTGGCCAACCAXCACTACTTTTGATTCCTCTAGGCTGGCT
AAATGTTTGGTACCGGGGATATTATCTTGCAACATCTCGTGAATTGACTCGGCTTGACTCAATTACAAAAGCACCCGTTATTCATCATTT
CTCTGAAAGCATCTCATGTGTTATGACTATACGCTGCTTTAGGAAGCAGGAGATGTTTAGTCAAGAAAACGTTAACCGAGTTGATGCCAA
TCTGCGAATGGATTTCCACAACAATGGATCCAATGAGTGGTTGGGATTTCGACTGGAACTGCTTGGAAGCTTGCTTCTCTGTGTTTCTGC
AATGTTCATGATTATCTTACCTAGCAGCATCATCAAGCCAGAGAATGTTGGCTTATCGATATCATATGGTTTGTCCCTTAACAGTGTGCT
ATTCTGGTCCGTCTTTGTGAGTTGCTTCGTGGAAAACAAAATGGTTTCTGTTGAAAGATTAAAACAGTTCTCATGCATACCATCAGAAGC
TGAGTGGCGAAAAAGGGATTTTGTCCCACCTTCAGATTGGCCGAACCATGGCAATGTTGAGCTTGAAGACTTACAAGTTAGGTATCGTCC
AAATACTCCTCTAGTGCTTAAAGGAATTACTCTCAACATTAGAGGGGGAGAGAAGATCGGTGTTGTTGGTCGTACTGGAGGTGGAAAATC
AACACTTATTCAAGTTTTCTTCCGTTTGGTGGAGCCTGCAGCTGGAAGAATAGTCATTGACGGCATTGACATATCCAGGCTCGGGCTTCA
TGATCTTAGATCTCGCTTTGGGATCATTCCTCAAGAACCAGTTCTTTTTGAAGGAACTGTGAGAAGCAACATTGACCCCATTGGACAATA
TTCAGATGATGAAATTTGGAAGAGCCTCGATCGCTGCCAACTGAAAGAAGTGGTGTCTTCAAAACCCGAAAAGCTTGACTCACCAGTTGT
TGATAATGGAGACAACTGGAGTGTTGGGCAGAGGCAGCTTCTTTGCTTAGGAAGAGTGATGCTAAAACGAAGCAGACTTCTATTTATGGA
CGAGGCAACCGCCTCTGTTGATTCACAGACAGATGCTGTGATTCAGAAAATCATCCGCGAGGACTTCAACGCCTGTACTATAATCAGCAT
TGCCCACAGAATACCAACAGTCATGGACTGTGATAGAGTTCTTGTTGTAGATGCAGGAATAGCAAAAGAGTTTGACAAACCATCTCATTT
GCTGGAAAGGCCTTCACTTTTTGGGGCTTTGGTTCAAGAATATGCCAACAGATCATCTGAGCTCTAA(3')CCACACACCATTTTGGCTT
TTCTTGGTGTTTTGCTTTGTAATTTGCAAAATACCTATCCAAATATTTACAAATAGTATCATCTCCCACTAGTCTATTTTGTAAATTTTG
TTGAGTTGTAGTAACAATATTGCCATTAAAACAATAGTAGTTGCTGTTTCCATTAATAAAAAAAACAAGGTTATTTTATCTAGGCTGATT
ATTTCTCTTCCAATCCTCAAGCGGTTTGAGATTCAGAAAGACTTGTGTTTGGTTATACTTTTTGTAAAGAATATTTGAAATAATGTTTAT
GTTGAAAAGTATTGGGGATAAAAAACAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan