ESTScan Details for Unigene SGN-U565427

Score 
170
Direction 
Reverse
Predicted Peptide Sequence 
MMQIDIKQSNSNLPVHGITYFWNDPQLLDTVATSSNSNVKWIDITTQTGITKVQLQHWQWPECTXMTSVIRASAFKYSKYQGFXYEVHLI
DTRGTLLTLATTRIESTLSNIFQXEDVPIKLRNMVKSFPFLIEDIATTYVICRKVFSEMRPQDYVQPLRDHHPCGQTKNQALAVK*SHQK
ILANPKDFDLWVLYKRQLGPGLALGPLFLSSK*
Predicted Coding Sequence 
ATGATGCAGATTGACATCAAGCAATCAAATAGCAATCTCCCAGTTCATGGAATCACCTATTTTTGGAATGATCCCCAGTTGCTGGACACT
GTTGCAACTTCTTCAAACAGTAATGTCAAATGGATAGATATAACTACACAAACAGGAATCACTAAAGTTCAACTTCAGCACTGGCAGTGG
CCTGAGTGCACAATXATGACTAGTGTGATTCGTGCATCTGCATTCAAATATAGTAAGTACCAAGGATTTXTGTATGAAGTTCACCTAATT
GATACGAGGGGAACACTTCTCACACTGGCTACCACCAGGATAGAAAGTACCTTGAGTAACATTTTTCAAGXTGAAGATGTCCCAATCAAA
CTACGGAACATGGTGAAGTCATTTCCTTTCTTGATTGAAGACATTGCAACCACATATGTGATATGTAGAAAAGTATTCTCAGAGATGAGA
CCACAAGACTACGTTCAGCCGTTGAGGGACCATCATCCTTGTGGGCAGACAAAAAACCAAGCACTTGCAGTGAAGTGAAGCCATCAAAAG
ATATTGGCAAATCCTAAAGATTTTGATTTGTGGGTCCTCTACAAAAGGCAATTAGGTCCAGGATTAGCTTTAGGACCATTATTTCTGTCC
TCAAAATGA
Edits in Original Sequence 
AAGTTATAATTTTTTCCATATCAATATGATAAAGATACGTTTTAAAATTTTTGTCAAAGTTCTTATAGTTTGATTCTAAAAATAGAAATC
ATGACAATTAAACATGAACGGAGGTAGTACATATTATACATATATGGCACGTACTATTTTTAGTTCAAGCAGTTGGGTGAGAAGTTATAG
GTTAATTCTACTTAAATAATTTTTCTCCTTGGCCAAAAG
(5')ATGATGCAGATTGACATCAAGCAtATCAAATAGCAATCTCCCAGTTC
ATGGAATCACCTATTTTTGGAATGATCCCCAGTTGCTGGACACTGTTGCAACTTCTTCAAACAGtTAATGTCAAATGGATAGATATAAtC
TACACAAACAGGAATCACTAAAGTTCAACTTCAGCACTGGCtAGTGGCCTGAGTGCACAATXATGACTAGTGTGATTCGTGCATCTGCAT
TCAAATATAGTAAGTACCAAGGATTTXTGTATGAAGTTCACCTAATTGATACGAGGGGAACACTTCTCACACTGGCTACCACCAGGATAG
AAAGTACCTTGAGTAACATTTTTCAAGXTGAAGATGTCCCAATCAAACTACGGAACATGaGTGAAGTCATTTCCTTTCTTGATTGAAGAC
ATTGCAACCACATATGTGATATGTAGAAAAGTATTCTCAGAGATGAGtACCACAAGACTACGTTCAGCCGTTGAGGGACCATCATCCTTG
TGGGCAGACAAAAAACCAAGCACTTGCAGTGAAGTGAAGCCATCAAAAGATATTGGCAAATCCTAAAGATTTTGATTTGTGGGTCCTCTA
CAAAAGGCAATTAGGTCCAGGATTAGCTTTAGGACCATTATTTCTGTCCTCAAAATGA(3')TGATACTTGTGAAAAATAACACTTCTTT
TTGCACTGTTTCTTGGTGAATGCAACTGATGTATCTCTGTTAAATCACTAAAGATAAATCAAAGGTTAAATCAAGTCATCACACTAGAAT
TTAATCTAGATAACACGATAAAACTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan