ESTScan Details for Unigene SGN-U565448

Score 
1184
Direction 
Forward
Predicted Peptide Sequence 
NGTPFWSLRASHSSFSLFSQHLGFLLLHSGLYLSPVESDNSFQQSLSKNNQSSKEATTGINNGQSGFVASDTTNTITQAKSNLLIFVDFI
LLLFCEKMTILIEQPEFGSQVEEKKVSFNANELILDGGFMVPKTLSSQDEIFEVPDINAFGQSFRDYNVESERQKSVEEFYRVQHINQTY
DYVKKMRKEYGKLNKIEMSIWDCCELLNDVVDDSDPDLDEPQIEHLLQTAEAIRKDYPNEDWLHLTGLIHDLGKVLLHPSFGGLPQWAVV
GDTFPLGCAFDESIVHHKYFKENPDINNNIYNTKNGVYEEGCGLDKVVMSWGHDDYMYLIAKENKTTLPSAALFVIRYHSFYALHRSGAY
THLMNEEDKENMKWLNIFNKYDLYSKSKVRIDVEKVKPYYLSLIEKYFPXKAEVVIESMVAE*
Predicted Coding Sequence 
AATGGTACCCCTTTTTGGAGTTTAAGAGCCTCCCACAGTAGCTTTTCCCTGTTTTCACAGCATCTCGGATTTTTGCTACTTCATTCTGGT
CTGTATCTTTCCCCTGTAGAAAGCGACAATTCCTTCCAACAATCTCTTTCGAAGAATAACCAGTCTAGTAAAGAAGCCACTACTGGCATA
AACAATGGGCAATCTGGTTTTGTGGCATCAGATACGACAAATACAATAACACAAGCAAAATCTAATTTGTTAATTTTTGTTGATTTTATT
TTATTATTATTTTGTGAGAAAATGACTATTCTCATTGAGCAGCCTGAATTTGGATCACAAGTGGAGGAGAAAAAAGTCTCATTCAATGCC
AATGAACTTATTTTGGATGGTGGATTTATGGTACCAAAGACATTGTCTTCTCAAGATGAAATATTTGAAGTGCCAGACATAAATGCATTT
GGTCAATCATTTAGGGATTATAATGTAGAAAGTGAGAGACAAAAATCAGTGGAAGAATTTTATAGGGTTCAACACATTAATCAAACATAT
GACTATGTGAAAAAAATGAGAAAAGAATATGGAAAATTGAACAAAATTGAAATGAGTATTTGGGATTGTTGTGAACTTTTGAATGATGTA
GTTGATGATAGTGATCCTGATTTGGATGAACCACAAATTGAGCATTTGTTACAAACTGCTGAAGCTATTAGAAAAGATTATCCAAATGAA
GATTGGCTTCATTTGACCGGCCTCATTCACGACCTAGGTAAAGTACTTCTTCATCCAAGTTTTGGAGGGCTTCCTCAATGGGCTGTTGTT
GGAGACACATTTCCTCTTGGTTGTGCTTTTGATGAATCAATTGTTCACCACAAGTATTTTAAGGAAAATCCAGACATCAACAACAATATT
TATAATACAAAAAATGGTGTATATGAAGAAGGTTGTGGACTTGACAAAGTTGTTATGTCATGGGGACATGATGATTATATGTATTTAATT
GCAAAGGAAAATAAAACTACTCTTCCTTCTGCTGCTTTATTTGTCATACGTTACCACTCTTTCTATGCATTACATAGATCAGGAGCATAT
ACACACTTGATGAATGAGGAGGACAAAGAGAACATGAAGTGGCTCAACATTTTTAATAAATATGATTTATATAGCAAGAGTAAAGTTCGA
ATTGATGTGGAAAAAGTCAAGCCATACTATCTCTCTCTTATCGAAAAGTATTTTCCAAXCAAAGCTGAGGTGGTAATTGAATCCATGGTG
GCAGAGTAG
Edits in Original Sequence 
(5')AATGGTACCCCTTTTTGGAGTTTAAGAGCCTCCCACAGTAGCTTTTCCCTGTTTTCACAGCATCTCGGATTTTTGCTACTTCATTC
TGGTCTGTATCTTTCCCCTGTAGAAAGCGACAATTCCTTCCAACAATCTCTTTCGAAGAATAACCAGTCaTAGTAAAGAAGCCACTACTG
GCATAAACAATaGGGCAATCTGGTTTTGTGGCATCAGATACGACAAATACAATAACACAAGCAAAATCTAATTTGTTAATTTTTGTTGAT
TTTATTTTATTATTATTTTGTGAGAAAATGACTATTCTCATTGAGCAGCCTGAATTTGGATCACAAGTGGAGGAGAAAAAAGTCTCATTC
AATGCCAATGAACTTATTTTGGATGGTGGATTTATGGTACCAAAGACATTGTCTTCTCAAGATGAAATATTTGAAGTGCCAGACATAAAT
GCATTTGGTCAATCATTTAGGGATTATAATGTAGAAAGTGAGAGACAAAAATCAGTGGAAGAATTTTATAGGGTTCAACACATTAATCAA
ACATATGACTATGTGAAAAAAATGAGAAAAGAATATGGAAAATTGAACAAAATTGAAATGAGTATTTGGGATTGTTGTGAACTTTTGAAT
GATGTAGTTGATGATAGTGATCCTGATTTGGATGAACCACAAATTGAGCATTTGTTACAAACTGCTGAAGCTATTAGAAAAGATTATCCA
AATGAAGATTGGCTTCATTTGACCGGCCTCATTCACGACCTAGGTAAAGTACTTCTTCATCCAAGTTTTGGAGGGCTTCCTCAATGGGCT
GTTGTTGGAGACACATTTCCTCTTGGTTGTGCTTTTGATGAATCAATTGTTCACCACAAGTATTTTAAGGAAAATCCAGACATCAACAAC
AATATTTATAATACAAAAAATGGTGTATATGAAGAAGGTTGTGGACTTGACAAAGTTGTTATGTCATGGGGACATGATGATTATATGTAT
TTAATTGCAAAGGAAAATAAAACTACTCTTCCTTCTGCTGCTTTATTTGTCATACGTTACCACTCTTTCTATGCATTACATAGATCAGGA
GCATATACACACTTGATGAATGAGGAGGACAAAGAGAACATGAAGTGGCTCAACATTTTTAATAAATATGATTTATATAGCAAGAGTAAA
GTTCGAATTGATGTGGAAAAAGTCAAGCCATACTATCTCTCTCTTATCGAAAAGTATTTTCCAAXCAAAGCTGAGGTGGTAATTGAATCC
ATGGTGGCAGAGTAG(3')AAATATATAATAATTAATTGTTATTTTTAATTATAGAGAAAAAAATATTTTTAGCTATATTTCATACTCAT
TTACGTTGATTATTAAATTAAAATATTTATCTTTACGAATTGTAATTTTCTAATTTTTTTTGGAAATGTATTTCTTTCGTTTCATTCACA
AATAAATTCTATTGAGATTTTACGGTCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan