ESTScan Details for Unigene SGN-U565780

Score 
765
Direction 
Forward
Predicted Peptide Sequence 
XTMSGGGDAVAAGGXKDAGPTVIVLKLDLHCEGCAKKVKRSIRHLEGVEDVKTDCDGGKLTVKGNVDPAMAPGESSDEDEEDGGAVSPQP
KKDAGAGAGGGDKKPDEKKAEEKKPEDKKPKEPQVSTVVLKIRLHCDGCAHKIKRIIKKIDGVEEVKVDSEKDLVNVKGTMDLKELIPYL
KDKLKRNVEIIPPKKDDGGGEKKEGGGGGGEKKEKEGGEQKAEGSKGVETKSEANKLEYYGYNAQTHYAMPVYNQSYMNQDYGLTMYDPG
YNAHXGLRHGVWLPPTVICTTSSTNDILEQRTNVXVTRILMVVLSCDSRDRSFIINVEGESSSENVNTLRKCLNI*
Predicted Coding Sequence 
XXGACCATGTCCGGCGGCGGTGACGCTGTCGCCGCCGGTGGAAAXAAGGATGCCGGTCCTACCGTCATAGTTTTAAAACTCGATTTGCAT
TGTGAAGGCTGTGCCAAAAAAGTCAAACGTTCCATTCGCCATCTCGAAGGTGTGGAGGACGTGAAGACGGACTGTGACGGTGGAAAATTG
ACGGTGAAAGGGAACGTGGATCCGGCXATGGCTCCGGGAGAAAGTAGCGATGAAGACGAAGAAGACGGTGGTGCTGTTTCTCCTCAGCCT
AAAAAGGACGCCGGCGCCGGCGCCGGCGGTGGAGATAAAAAACCCGATGAGAAAAAGGCAGAAGAGAAAAAACCTGAAGATAAGAAGCCT
AAAGAGCCACAAGTAAGTACAGTGGTGTTGAAGATTCGATTGCATTGTGATGGGTGTGCACACAAAATAAAGAGAATTATAAAGAAAATT
GATGGGGTAGAAGAAGTCAAAGTAGATTCGGAAAAAGATTTGGTCAATGTTAAGGGTACAATGGACTTGAAGGAATTAATTCCTTATTTG
AAAGATAAATTGAAAAGAAATGTAGAAATCATCCCACCTAAGAAAGATGATGGAGGTGGCGAAAAGAAAGAAGGCGGTGGCGGTGGTGGX
GAGAAGAAAGAGAAAGAAGGGGGTGAACAAAAAGCCGAAGGAAGTAAAGGTGTGGAGACAAAGTCCGAAGCGAATAAATTAGAGTATTAT
GGTTACAATGCACAAACACATTACGCGATGCCTGTGTACAACCAAAGTTACATGAATCAAGACTATGGTCTAACAATGTACGATCCCGGT
TACAACGCTCATXACGGGCTACGCCATGGAGTATGGCTACCACCAACCGTCATATGTACCACCTCCTCCACCAACGACATACTTGAACAA
CGCACAAATGTTCXAGTGACGAGAATCCTAATGGTTGTTCTGTCATGTGATTCACGTGACAGATCATTCATCATCAATGTTGAGGGAGAG
AGTTCAAGTGAAAATGTAAATACATTAAGAAAATGTCTCAATATCTAA
Edits in Original Sequence 
(5')XXGACCATGTCCGGCGGCGGTGACGCTGTCGCCGCCGGTGGAAAXAAGGATGCCGGTCCTACCGTCATAGTTTTAAAACTCGATTT
GCATTGTGAAGGCTGTGCCAAAAAAGTCAAACGTTCCATTCGCCATCTCGAAGGTGTGGAGGACGTGAAGACGGACTGTGACGGTGGAAA
ATTGACGGTGAAAGGGAACGTGGATCCGGCXATGGCTCCGGGAGAAAGTAGCGATGAAGACGAAGAAGACGGTGGTGCTcGTTTCTCCTC
AGCCTAAAAAGGACGCCGGCGCCGGCGCCGGCGGTGGAGATAAAAAACCCGATGAGAAAAAGGCAGAAGAGAAAAAACCTGAAGATAAGA
AGCCTAAAGAGCCACAAGTAAGTACAGTGGTGTTGAAGATTCGATTGCATTGTGATGGGTGTGCACACAAAATAAAGAGAATTATAAAGA
AAATTGATGGGGTAGAAGAAGTCAAAGTAGATTCGGAAAAAGATTTGGTCAATGTTAAGGGTACAATGGACTTGAAGGAATTAATTCCTT
ATTTGAAAGATAAATTGAAAAGAAATGTAGAAATCATCCCACCTAAGAAAGATGATGGAGGTGGCGAAAAGAAAGAAGGCGGTGGCGGTG
GTGGXGAGAAGAAAGAGAAAGAAGGGGGTGAACAAAAAGCCGAAGGAAGTAAAGGTGTGGAGACAAAGTCCGAAGCGAATAAATTAGAGT
ATTATGGTTACAATGCACAAACACATTACGCGATGCCTGTGTACAACCAAAGTTACATGAATCAAGACTATGGTCTAACAATGTACGATC
CCGGTTACAACGCTCATXACGGGCTACGCCATGGAGTATGGCTACCACCAACCGTCATATGTACCACCTCCTCCACCAACGACATACTTG
AACAACGCACAAATGTTCXAGTGACGAGAATCCTAATGGTTGTTCTGTCATGTGATTCACGTGACAGATCATTCgATCATCAATGTTGAG
GGAGAGAGTTCAAGTGAAAATGTAAATACATTAAGAAAATGTCTCAATATCTAA(3')AGATAACACAATGAATTGTAATTTACAAGTTC
TAATGAGATTTTACCCCGATACTTTGTATTAATTTGTGGGAAAAAATCACATATTATGAGACATTTAGAAAAATAATAATAATATGAAAT
GTATACGTAATGGTATATGAGGATATAGTTTCTTTTTAGGAATTGTCATTAGGTTTAATTAGGTTTATCTTTTGACTTGTATGTTATTAA
TATAATATATAGATAATAATATATTCAATTTTGTGACTACATATTTTTGTTATTTTCTTGTTCATTATTTACG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan