ESTScan Details for Unigene SGN-U565814

Score 
603
Direction 
Forward
Predicted Peptide Sequence 
MPLXVEQNCKAQDLHLFKVAINVLIWPKIVCGGDANGKFISYGNLKIDLKDEATPNSTTSAATSFSLALLPIVIADLTSDRQALLDFASA
VAHLRNFKWNTNSSICTWHGVSCSSDGTRVVALRLPGLGLYGPIPDNTIGRLDALTTLSLHSNALTGNLPSDITSLPSLRFIFIQQNKFS
GEIPSSLSLLLKFIDLSFNSFSGEVPTTIQNLTHLTGLNLQNNSLX
Predicted Coding Sequence 
ATGCCGTTGGXAGTAGAGCAGAATTGTAAGGCACAAGACTTGCACCTTTTTAAAGTGGCAATTAATGTTCTCATCTGGCCAAAGATTGTG
TGTGGTGGTGATGCAAATGGGAAGTTCATATCTTATGGCAACTTGAAAATAGATTTAAAAGATGAAGCTACACCCAATAGTACTACATCT
GCTGCTACCTCTTTCTCTCTTGCTCTTCTTCCCATTGTTATTGCTGACCTTACATCAGATAGACAAGCACTACTTGACTTTGCTTCTGCA
GTAGCTCATCTTCGAAACTTCAAGTGGAACACTAACTCTTCCATTTGCACATGGCATGGCGTAAGTTGCAGCTCAGATGGCACTCGTGTT
GTTGCACTTCGCCTTCCTGGACTTGGACTTTATGGTCCTATTCCAGACAATACCATAGGAAGACTAGATGCACTAACAACACTCAGCCTT
CATTCCAATGCCCTCACTGGAAATCTTCCTTCAGACATCACCTCTCTTCCCTCCCTCCGTTTCATATTTATACAACAAAACAAATTTTCT
GGTGAAATACCTTCTTCTCTATCTCTACTCCTTAAATTCATTGATCTCTCCTTCAACTCCTTCTCAGGGGAAGTTCCAACAACAATTCAA
AATCTGACACATCTTACTGGTTTGAACTTACAAAACAACTCCCTCAXX
Edits in Original Sequence 
GAACTTTTTGGTGAGGTGTATTGGAGACGAAACTAATAAATTAAGGGTGTAGGACTTTTTTGTTTTTTTTTGTGTGGATTAGTAATCAAT
AGTGGGAATTTCCAGTTGCCAATTGTGTGTGACAGCCAATGAGTAGTTCCGGTGAATGAGTAAATGGTTGAAAAATGACAAGGAAGAAGT
AGTTGGAGAGGTACCTCGAGATCTGTGCTAGAATAGCAGAGATTCCGTTTGCTTCACGAAGAAGCTCAAACATTATTCTTTCTTTCTTTT
GATAAGAGGAAAAAGAAAAGAAAAGATTTTTCCTTCCTTCCTACTGCTTTAATTTTTCCTACCGGTACCACCAGCTGCAGCTGCAGAGTG
CAGAGTAGGAAGGAAAAAAAGAATAATCTGATTTTGCAAAGTAAACAAA
(5')ATGCCGTTGGXAGTAGAGCAGAATTGTAAGGCACAAG
ACTTGCACCTTTTTAAAGTaGGCAATTAATGTTCTCATCTGGCCAAAGATTGTGTGTGGTGGTGATGCAAATGGGAAGTTCATATCTTAT
GGCAACTTGAAAATAGATTTAAAAtGATGAAGCTACACCCAATAGTACTACATCTGCTGCTACCTCTTTCTCTCTTGCTCTTCTTCCCAT
aTGTTATTGCTGACCTTACATCAGATAGACAAGCACTACTTGACTTTGCTTCTGCAGTAGCTCATCTTCGAAACTTCAAGTGGAACACTA
ACTCTTCCATTTGCACATGGCATGGCGTAAGTTGCAGCTCAGATGGCACTCGTGTTGTTGCACTTCGCCTTCCTGGACTTGGACTTTATG
GTCCTATTCCAGACAATACCATAGGAAGACTAGATGCACTAACAACACTCAGCCTTCATTCCAATGCCCTCACTGGAAATCTTCCTTCAG
ACATCACCTCTCTTCCCTCCCTCCGTTTCATATTTATACAACAAAACAAATTTTCTGGTGAAATACCTTCTTCTCTATCTCTACTCCTTA
AATTCATTGATCTCTCCTTCAACTCCTTCTCAGGGGAAGTTCCAACAACAATTCAAAATCTGACACATCTTACTGGTTTGAACTTACAAA
ACAACTCCCTCAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan