Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U565831

Score 
1275
Direction 
Forward
Predicted Peptide Sequence 
XETQQIIVSKLNNGAKNKIQIVHVPKANNFTEQRQNHEHILWTKEIQIHMKHITHQKSSSSSSQPNKSMAASLSSLFLSNPRPFRPPINP
KSNPHLVFPLRTLNFSAKPNPPPPNSNAKQPPTIREPPLPTPPVGDEKKSFAVATGELFLGIASRVLRRGSSLVNGSNEEPAGVTMFKDD
EESESYFLKRRKEGIASVVEDPVQPEVVWEQTEKDVEAEKSLKTVTSPGFSFSAAGLLFPYHLGVAKLLIEKGYIKETTPLAGSSAGAIV
CVVVASGASMQEALDATKILAQDCRLKGTAFRLGAVLREVLEKFLPDDAHIRCNGRVRVAXNTDTLEAQRLVVDQFDSKEDLINAVFTSS
FIPGYLAPRPATFFRNRLCIDGGLTLFMPPTSAAQTVRICAFPASRLGLQGIGISPDCNPDSRATPRQLLNWALEPAEDDILDKLFEQGY
VDAAVWAKENPVEDLIRDDDSSSLGISLVQ*
Predicted Coding Sequence 
XXGGAAACTCAACAAATCATCGTCTCCAAACTCAACAATGGAGCAAAGAACAAAATCCAAATAGTTCATGTTCCAAAAGCTAACAATTTT
ACAGAGCAAAGGCAAAATCACGAGCATATACTATGGACGAAAGAAATACAAATACATATGAAACATATTACCCATCAAAAATCATCATCT
TCTTCTTCTCAACCTAACAAATCAATGGCTGCTTCACTATCTTCCCTTTTCCTCTCAAACCCTCGTCCTTTTCGCCCTCCTATAAACCCT
AAATCTAATCCCCATCTCGTTTTTCCACTTCGTACCCTCAATTTCTCCGCTAAACCTAACCCACCCCCTCCGAACTCCAATGCAAAACAA
CCACCCACCATCAGAGAACCGCCGTTGCCTACTCCGCCAGTGGGGGATGAGAAGAAGTCGTTTGCGGTGGCGACCGGCGAGCTTTTCCTT
GGGATTGCTTCACGAGTTTTGAGGCGTGGAAGTAGTTTAGTTAATGGGTCGAATGAGGAGCCGGCTGGTGTGACTATGTTCAAGGATGAT
GAAGAGAGTGAGTCTTACTTTTTGAAAAGGAGGAAGGAAGGGATAGCGTCGGTGGTTGAGGACCCTGTTCAGCCGGAGGTTGTGTGGGAG
CAGACGGAGAAGGATGTGGAAGCTGAGAAGAGCTTGAAAACGGTGACTAGCCCTGGGTTTAGCTTCTCTGCTGCTGGGCTTTTGTTTCCC
TATCATCTTGGGGTTGCTAAGCTTCTCATTGAGAAGGGCTATATCAAGGAGACAACACCACTAGCTGGTTCGTCTGCTGGTGCAATTGTC
TGTGTAGTGGTTGCTTCTGGTGCCAGTATGCAAGAGGCTCTAGATGCTACGAAAATATTAGCTCAAGATTGTCGGCTCAAAGGGACAGCA
TTTCGCCTTGGGGCTGTTCTTAGAGAAGTTCTAGAGAAATTTCTTCCAGATGATGCTCATATTAGATGCAATGGAAGAGTTCGTGTTGCT
GXTAACACAGATACTTTGGAGGCCCAGAGGCTTGTTGTTGATCAGTTTGATTCAAAGGAAGATCTTATCAATGCTGTCTTTACTTCTTCG
TTTATCCCAGGATATCTTGCTCCGAGACCAGCCACGTTTTTCAGGAATAGATTGTGTATTGATGGGGGGCTGACACTGTTTATGCCGCCG
ACATCTGCTGCTCAGACGGTGCGCATTTGTGCATTTCCAGCCAGTCGTTTGGGATTGCAAGGAATTGGGATAAGTCCTGACTGCAACCCC
GATAGCAGGGCCACTCCCCGCCAGCTTCTCAATTGGGCACTCGAGCCTGCAGAAGATGATATTCTTGATAAGCTCTTTGAACAAGGTTAT
GTGGATGCAGCTGTGTGGGCCAAGGAGAACCCAGTTGAGGACTTAATTCGAGATGATGACAGTTCTTCCCTAGGCATCAGTCTTGTACAA
TAG
Edits in Original Sequence 
(5')XXGGAAACTCAACAAATCATCGTCTCCAAACTCAACAATGGAGCAAAGAACAAAATCCAAATAGTTCATGTTCCAAAAGCTAACAA
TTTTACAGAGCAAAGGCAAAATCACGAGCATATACgTATGGACGAAAGAAATACAAATACATATGAAACATATTACCCATCAAAAATCAT
CATCTTCTTCTTCTCAACCTAACAAATCAATGGCTGCTTCACTATCTTCCCTTTTCCTCTCAAACCCTCGTCCTTTTCGCCCTCCTATAA
ACCCTAAATCTAATCCCCATCTCGTTTTTCCACTTCGTACCCTCAATTTCTCCGCTAAACCTAACCCACCCCCTCCGAACTCCAATGCAA
AACAACCACCCACCATCAGAGAACCGCCGTTGCCTACTCCGCCAGTGGGGGATGAGAAGAAGTCGTTTGCGGTGGCGACCGGCGAGCTTT
TCCTTGGGATTGCTTCACGAGTTTTGAGGCGTGGAAGTAGTTTAGTTAATGGGTCGAATGAGGAGCCGGCTGGTGTGACTATGTTCAAGG
ATGATGAAGAGAGTGAGTCTTACTTTTTGAAAAGGAGGAAGGAAGGGATAGCGTCGGTGGTTGAGGACCCTGTTCAGCCGGAGGTTGTGT
GGGAGCAGACGGAGAAGGATGTGGAAGCTGAGAAGAGCTTGAAAACGGTGACTAGCCCTGGGTTTAGCTTCTCTGCTGCTGGGCTTTTGT
TTCCCTATCATCTTGGGGTTGCTAAGCTTCTCATTGAGAAGGGCTATATCAAGGAGACAACACCACTAGCTGGTTCGTCTGCTGGTGCAA
TTGTCTGTGTAGTGGTTGCTTCTGGTGCCAGTATGCAAGAGGCTCTAGATGCTACGAAAATATTAGCTCAAGATTGTCGGCTCAAAGGGA
CAGCATTTCGCCTTGGGGCTGTTCTTAGAGAAGTTCTAGAGAAATTTCTTCCAGATGATGCTCATATTAGATGCAATGGAAGAGTTCGTG
TTGCTGXTAACACAGATACTTTGGAGGCCCAGAGGCTTGTTgGTTGATCAGTTTGATTCAAAGGAAGATCTTATCAATGCTGTCTTTACT
TCTTCGTTTATCCCAGGATATCTTGCTCCGAGACCAGCCACGTTTTTCAGGAATAGATTGTGTATTGATGGGGGGCTGACACTGTTTATG
CCGCCGACATCTGCTGCTCAGACGGTGCGCATTTGTGCATTTCCAGCCAGTCGTTTGGGATTGCAAGGAATTGGGATAAGTCCTGACTGC
AACCCCGATAGCAGGGCCACTCCCCGCCAGCTTCTCAATTGGGCACTCGAGCCTGCAGAAGATGATATTCTTGATAAGCTCTTTGAACAA
GGTTATGTGGATGCAGCTGTGTGGGCCAAGGAGAACCCAGTTGAGGACTTAATTCGAGATGATGACAGTTCTTCCCTAGGCATCAGTCTT
GTACAATAG(3')TTTTATCATAACATAAGGACTGATTTAGTTTAAGAGTGTATGAGATCAAGACGATGGATACACGGACGTTGCAATAA
TCAGCTCTAGGGTACACACTTCAACAACGATGGAGCTGTTGCCTTAACAAGGAGCTGGTAATACTGAGGAAGAACGAAGAGGGTCCGAAA
CTGGTGGTAGGTTAGCAGCAAGGTTCTGTATATAACATTGCAAAGATGTAAATTGTAAAGGAGTCACAGAAAAAACAATAAAGAGCACAG
GGTTTTGGATATGGAGTATTATTGGGGTTCTATTTTGAAGTGAATATTGTTGTAAAATAGTACTACATATTTGTGATAATAATTCTGTTA
TATCAGCAAGATTTTTACATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan