ESTScan Details for Unigene SGN-U566055

Score 
572
Direction 
Forward
Predicted Peptide Sequence 
MKVHSCIHPLPSTPSTGILVSAGPAEAKLAANTRKLYSLTLNSSNYVPFPYKDQKFSRSSSTDFSRTAIGSNVSEDTDDMFDDLLRTHGK
VVYKRNDQKPASEEIDDDAESLSFAMAVAKVASDVKAGDIKVLFVKPLVYWTRFFIIATAFSRPQIDAIGTRVRDMAEEQYGRVASGDSK
PNSWTLLDFGDVVVHLFLPPQREYYNLEEFYGNAASIELPFENQQQLRGPTGYXKSQQLWPRGXLTESVANYEAITVFPPIADKERLTYL
GKXLLIHWLRYFS*
Predicted Coding Sequence 
ATGAAAGTACACTCCTGCATTCATCCTCTTCCCTCTACTCCCTCCACCGGAATTTTGGTCTCTGCCGGTCCTGCGGAAGCTAAGCTTGCT
GCTAACACCAGAAAGCTTTATTCTTTAACTTTGAATTCCTCTAATTATGTCCCATTTCCTTATAAAGATCAGAAATTTTCCAGAAGCAGC
TCTACGGATTTTTCTAGAACGGCTATCGGTTCGAATGTAAGTGAAGATACAGATGACATGTTTGATGATCTCCTAAGAACGCATGGCAAA
GTGGTATACAAAAGAAATGACCAAAAACCTGCAAGTGAGGAGATTGATGATGATGCTGAAAGCCTATCGTTTGCAATGGCTGTGGCTAAA
GTTGCAAGTGATGTCAAGGCTGGAGATATAAAGGTCCTCTTTGTCAAGCCTCTAGTATATTGGACTCGGTTTTTCATTATTGCTACTGCA
TTCTCTCGCCCACAGATTGATGCCATTGGGACCAGAGTAAGAGATATGGCTGAGGAACAATATGGAAGAGTTGCTTCTGGAGATTCAAAA
CCCAACTCGTGGACACTACTGGACTTTGGTGATGTCGTTGTTCATCTATTTCTTCCTCCGCAGCGTGAGTACTACAACCTGGAAGAATTC
TATGGCAATGCAGCATCCATCGAACTACCATTTGAGAACCAACAACAATTGCGAGGACCTACTGGTTATXTGAAGTCCCAACAGTTATGG
CCTCGTGGTGXATTAACAGAAAGTGTAGCAAATTATGAGGCAATCACAGTGTTCCCXCCGATTGCTGACAAGGAACGATTAACATATCTG
GGCAAAXCTCTGTTGATCCACTGGTTGCGTTATTTTTCTTAA
Edits in Original Sequence 
AAAAACGAGATACTTGTATAGGAAGGGTGAGAAGATAGAAAATTTATTTGGTTCAAGCAACTGAGTTTCCCCATACAATCCTCTCTTGTG
CAGTATCTTCTAAAGTTGAAATCTCGTATAGAAAA
(5')ATGAAAGTACACTCCTGCATTCATCCTCTTCCCTCTACTCCCTCCACCGGA
ATTTTGGTCTCTGCCGGTCCTGCGGAAGCTAAGCTTGCTGCTAACACCAGAAAGCTTTATTCTTTAACTTTGAATTCCTCTAATTATGTC
CCATTTCCTTATAAAGATCAGAAATTTTCCAGAAGCAGCTCTACGGATTTTTCTAGAACGGCTATCGGTTCGAATGTAAGTGAAGATACA
GATGACATGTTTGATGATCTCCTAAGAACGCATGGCAAAGTGGTATACAAAAGAAATGACCAAAAACCTGCAAGTGAGGAGATTGATGAT
GATGCTGAAAGCCTATCGTTTGCAATGGCTGTGGCTAAAGTTGCAAGTGATGTCAAGGCTGGAGATATAAAGGTCCTCTTTGTCAAGCCT
CTAGTATATTGGACTCGGTTTTTCATTATTGCTACTGCATTCTCTCGCCCACAGATTGATGCCATTGGGACCAGAGTAAGAGATATGGCT
GAGGAACAATATGGAAGAGTTGCTTCTGGAGATTCAAAACCCAACTCGTGGACACTACTGGACTTTGGTGATGTCGTTGTTCATCTATTT
CTTCCTCCGCAGCGTGAGTACTACAACCTGGAAGAATTCTATGGCAATGCAGCATCCATCGAACTACCATTTGAGAACCAACAACAATTG
CGAGGACCTACTGGTTATXTGAAGTCCCAACAGTTATGGCCTCGTGGTGXATTAACAGAAAGTGTAGCAAATTATGAGGCAATCACAGTG
TTCCCXCCGATTGCTGACAAGGAACGATTAACATATCTGGGCAAAXCTCTGTTGATCCACTGGTTGCGTTATTTTTCTTAA(3')ATTAG
TAGTAAGATAAAGCTCTCTACTAAGTTGTCTCTGTAGAAGTATTGGTTAAGAAATAGTTTACAAGCATTCTGAACTAATAAAGGCTCATT
GTCACGTTTGATGAAAGAACCTAACATCCTGCTTCTTTTTCCCTTGATGTGAGTTGAGTTTAAATGAAGAATGAAGATTTAAATACTTTT
GGGACTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan