ESTScan Details for Unigene SGN-U566243

Score 
714
Direction 
Forward
Predicted Peptide Sequence 
XRTLDLTGQPFPNSLSSLHLIKPKDFFFFLSTKTSHLYINQSTRRFSGCFITEIIIIIASTVVKPLIIAGLTNFMENSSNKETAMRLREV
AEGAVKAIGLGFDIVDDLRLKFCKDYQLISVDHDQVRDISIPGGILVQNVPKSINCDKGERMRFTSDILSFSQMSERFNQDLSLSGKIPS
GHFNAAFEYTTCWQKDAAYTKALAFDGVFITLYNIALEKAQVVLRDHVKQAIPSSWDPVALTRFIEKYGTHVIVGVKMGGKDVVYVKQQY
SSTLQPADIQKRLKEVADERFGNANVQSSTTLLANSEQQLPFMDSTSSTVHLHKEDFTFLWGKRGGNRIRNIPHXRWCQTVPVEPDVISV
SLIPISSLLSGIDGSGFLSHAINLYMXYKPPIEELFSFWESSFQGNGGPVFGELPLGQERNSKVVX
Predicted Coding Sequence 
XXGCGAACACTTGATTTGACTGGCCAGCCATTCCCCAACTCCCTCTCTTCTCTTCACCTAATCAAACCCAAAGACTTTTTCTTCTTCTTG
TCAACTAAAACTTCACATTTGTATATTAATCAGTCAACACGACGTTTCTCCGGTTGCTTTATCACCGAAATAATCATCATAATTGCTTCT
ACAGTTGTTAAACCATTAATAATAGCXGGTTTAACGAATTTCATGGAGAACAGTAGTAACAAAGAGACGGCGATGAGACTTAGAGAGGTG
GCCGAAGGAGCAGTAAAGGCGATTGGGTTAGGGTTTGATATAGTGGATGATTTGAGGTTGAAGTTTTGTAAGGATTATCAGTTGATCTCT
GTTGACCATGATCAGGTGCGAGACATTTCAATTCCTGGTGGAATTTTGGTTCAAAATGTTCCCAAATCTATCAATTGCGATAAAGGCGAA
CGCATGAGATTTACTTCTGATATTCTCTCTTTCTCCCAGATGTCCGAGCGATTTAATCAGGACCTATCCCTTTCTGGTAAGATTCCATCG
GGCCATTTCAATGCTGCTTTTGAATATACCACTTGTTGGCAAAAAGACGCTGCCTACACGAAAGCTCTTGCTTTTGATGGGGTCTTCATA
ACACTCTATAACATTGCATTAGAGAAGGCTCAAGTTGTACTGCGTGATCATGTTAAACAAGCAATTCCTTCATCTTGGGATCCAGTAGCA
TTGACAAGGTTTATTGAGAAATATGGTACCCATGTTATTGTTGGTGTAAAGATGGGTGGAAAGGATGTTGTATATGTCAAACAGCAATAT
TCTTCAACACTTCAGCCTGCTGATATACAGAAAAGGTTGAAAGAAGTGGCAGACGAAAGATTTGGCAATGCAAATGTACAATCCAGCACT
ACTTTGCTAGCTAATAGTGAACAACAGCTGCCCTTTATGGATTCAACTTCATCAACAGTTCATCTTCACAAAGAGGATTTTACATTCCTC
TGGGGGAAGAGAGGTGGAAACCGTATCAGAAATATCCCACATAANAGGTGGTGCCAAACTGTTCCAGTTGAACCAGACGTGATTTCAGTG
TCATTAATTCCAATATCATCATTATTGAGCGGGATTGATGGCAGTGGTTTTTTGAGCCATGCGATTAACTTGTACATGCNGTATAAACCA
CCAATTGAAGAGCTTTTCAGTTTTTGGGAGTCCAGCTTCCAAGGCAATGGGGGACCAGTGTTCGGTGAACTTCCTCTTGGTCAAGAGAGG
AACAGCAAAGTGGTGCXX
Edits in Original Sequence 
(5')XXGCGAACACTTGATTTGACTGGCCAGCCATTgCCCCAACTCCCTCTCTTCTCTTCACCTAATCAAACCCAAAGACTTTTTCTTCT
TCTTGTCAACTAAAACTTCACATTTGTATATTAATCAGTCAACACGACGTTTCTCCGGTTGCTTTATCACCGAAATAATCATcCATAATT
GCTTCTACAGTTGTTAAACCATTAATAATAGCXGGTTTAACGAATTTCATGGAGAACAGTAGTAACAAAGAGACGGCGATGAGACTTAGA
GAGGTGGCCGAAGGAGCAGTAAAGGCGATTGGGTTAGGGTTTGATATAGTGGATGATTTGAGGTTGAAGTTTTGTAAGGATTATCAGTTG
ATCTCTGTTGACCATGATCAGGTGCGAGACATTTCAATTCCTGGTGGAATTTTGGTTCAAAATGTTCCCAAATCTATCAATTGCGATAAA
GGCGAACGCATGAGATTTACTTCTGATATTCTCTCTTTCTCCCAGATGTCCGAGCGATTTAATCAGGACCTATCCCTTTCTGGTAAGATT
CCATCGGGCCATTTCAATGCTGCTTTTGAATATACCACTTGTTGGCAAAAAGACGCTGCCTACACGAAAGCTCTTGCTTTTGATGGGGTC
TTCATAACACTCTATAACATTGCATTAGAGAAGGCTCAAGTTGTACTGCGTGATCATGTTAAACAAGCAATTCCTTCATCTTGGGATCCA
GTAGCATTGACAAGGTTTATTGAGAAATATGGTACCCATGTTATTGTTGGTGTAAAGATGGGTGGAAAGGATGTTGTATATGTCAAACAG
CAATATTCTTCAACACTTCAGCCTGCTGATATACAGAAAAGGTTGAAAGAAGTGGCAGACGAAAGATTTGGCAATGCAAATGTACAATCC
AGCACTACTTTGCTAGCTAATAGTGAACAACAGCTGCCCTTTATGGATTCAACTTCATCAACAGTTCATCTTCACAAAGAGGATTTTACA
TTCCTCTGGGGGAAGAGAGGTGGAAACCGTATCAGAAATATCCCACATAANAGGTGGTGCCAAACTGTTCCAGTTGAACCAGACGTGATT
TCAGTGTCATTAATTCCAATATCATCATTATTGAGCGGGATTGATGGCAGTGGTTTTTTGAGCCATGCGATTAACTTGTACATGCNGTAT
AAACCACCAATTGAAGAGCTTTaTCAGTTTTTGGGAGTCCAGCTTCCAAGGCAATGGGGGACCAGTGTTCGGTGAACTTCCTCTTGGTCA
AGAGAGGAACAGCAAAGTGGTGCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan