Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U566296

Score 
338
Direction 
Forward
Predicted Peptide Sequence 
MGKELDHSKSLDKEEAVIMQNIDEDEIFPPEKKQESLCIRKIEGNKKTXDALNEDGSLDSAEESPVHGKSLCLARSFSSHFLINIDEMMS
DVGNEKGALISKTPKGKMGIFSFDRSSISSSEXIKLAATIMAVNTSYILEAXVAFFMYVNVISEKSPLVCCSENNILKSKDQEDDDSCSW
NRIQIEPTLRIRLKFQDVKYSVALKGVENSDTEKCILXGVX
Predicted Coding Sequence 
ATGGGGAAAGAACTAGATCACTCCAAGAGCCTTGACAAGGAAGAGGCTGTCATCATGCAGAATATCGATGAGGATGAGATTTTTCCACCT
GAAAAAAAACAGGAAAGTTTGTGCATTCGGAAAATAGAAGGCAATAAAAAGACTAXAGACGCGCTTAATGAAGATGGAAGCCTAGACTCT
GCTGAGGAATCACCAGTACATGGAAAATCTTTGTGTCTAGCAAGATCATTTAGTTCTCATTTTCTTATTAACATAGATGAGATGATGAGT
GATGTTGGTAATGAAAAAGGTGCACTTATAAGTAAGACTCCAAAAGGGAAAATGGGAATTTTCTCATTCGATCGATCCTCCATTTCCTCA
TCAGAAXACATAAAATTAGCAGCCACAATTATGGCAGTGAACACAAGTTATATACTAGAAGCTAXGGTTGCCTTTTTTATGTATGTGAAT
GTGATTTCTGAAAAAAGTCCCCTTGTTTGTTGTTCAGAGAACAATATATTGAAATCGAAGGATCAGGAGGATGACGATTCATGCAGCTGG
AATAGAATTCAGATTGAGCCTACCTTACGTATACGTCTCAAGTTTCAAGATGTGAAGTACTCCGTTGCACTGAAGGGAGTGGAGAATTCT
GATACAGAAAAGTGCATACTTNCAGGAGTGAXX
Edits in Original Sequence 
GATTGCATAGATCTTCCTAAGCTTGAGGTCTAACCAACCGAGATAA(5')ATGGGGAAAGAACTAGATCACTCCAAGAGCCTTGACAAGG
AAGAGGCTGTCATCATGCAGAATATCGATGAGGATGAGATTTTTCCACCTGAAAAAAAACAGGAAtAGTTTGTGCATTCGGAAAATAGAA
GGCAATAAAAAGACTAXAGACGCGCTTAATGAAGATGcGAAGCCTAGACTCTGCTGAGGAATCACCAGTACATGGAAAATCTTTGTGTCT
AGCAAGATCATTTAGTTCTCATTTTCTTATTAACATAGATGAGATGATGAGTGATGTTGGTAATGAAAAAGGTGCACTTATAAGTAAGAC
TCCAAAAGGGAAAATGGGAATTTTCTCATTCGATCGATCCTCCATTTCCTCATCAGAAXACATAAAATTAGCAGCCACAATTATGGCAGT
GAACACAtAGTTATATACTAGAAGCTAXGGTTGCCTTTTTTATGTATGTGAATGTGATTTCTGAAAAAAGTCCCCTTGTTTGTTGTTCAG
AGAACAATATATTGAAATCGAAGGATCAGGAGGATGACGATTCATGCAGCTGGAATAGAATTCAGATTGAGCCTACCTTACGTATACGTC
TCAAGTTTCAAGATGTGAAGTACTCCGTTGCACTGAAGGGAGTGGAGAATTCTGATACAGAAAAGTGCATACTTNCAGGAGTGAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan