ESTScan Details for Unigene SGN-U566356

Score 
715
Direction 
Forward
Predicted Peptide Sequence 
MAINYDGLVDYXNLKAEYFCSVLSSTSLSAPFIQNLVMDQAMAAIIRNRPFESSIPQSIWTVETVSQVLDQSPDSSSNPQDPLADKMGFA
TVPIKAEKPKTRVHNARKGVLILGPAAHRDVQKVQLGLEKALDFSIGLRPAVGLLTMSSLVEKCLLFLPKGRVIEVSLGISQKNVEKRAF
DDTDCYVFDKMPRRRRVGKEALTTFYRMKQFHCMPDVYAYNTLIFALCRVGNFKKAKFLMEQMELPGFRCPPDVFTYTILIALIVEMVRR
LAVEKLLEENMGGKSLVSIMLFKGFVPDVVTYNCLINGCCKTNRIERALELLDDMVKRGVVPNRITYNSFIRYYSVTNEIDKAIEMLRRM
QGMNHGVVLPCNSSYTPIIHAMCETGRVVEARDLLVEVAEQGSIPREYTYKLVRDALESSGKIDLLDEELCTRLEDGIKGRIRQVMKVKP
LLQHQTVSSH*
Predicted Coding Sequence 
ATGGCGATCAATTACGATGGCTTGGTTGATTATXATAATCTGAAAGCTGAATATTTTTGCTCTGTGTTGTCATCAACATCACTTTCTGCT
CCTTTCATCCAAAACCTTGTTATGGATCAAGCTATGGCTGCTATTATCAGAAATCGGCCATTTGAGTCTTCAATTCCCCAATCCATTTGG
ACTGTAGAAACAGTTTCTCAAGTCTTGGATCAATCCCCAGATTCCTCTTCCAATCCCCAAGATCCATTGGCCGACAAAATGGGTTTCGCC
ACCGTCCCCATTAAAGCAGAGAAACCTAAAACAAGAGTTCATAACGCTCGGAAGGGAGTACTCATTCTCGGACCGGCTGCTCATAGAGAT
GTTCAAAAGGTGCAATTAGGATTGGAGAAAGCATTGGATTTTTCCATTGGGTTGAGACCCGCTGTGGGTTTACTCACAATGAGCTCACTT
GTAGAGAAATGTCTCTTGTTCTTGCCAAAGGGTCGTGTAATTGAAGTTTCTTTGGGAATTTCTCAGAAGAATGTCGAGAAGAGGGCTTTT
GACGACACCGACTGTTACGTGTTTGATAAAATGCCTAGGAGAAGAAGGGTTGGTAAAGAAGCATTGACTACTTTCTACAGAATGAAGCAA
TTTCACTGTATGCCTGATGTTTATGCTTACAACACACTCATATTTGCTCTTTGTAGAGTTGGGAATTTCAAAAAAGCTAAGTTCTTGATG
GAGCAAATGGAGTTGCCTGGTTTTAGGTGTCCACCCGATGTCTTTACTTACACAATCTTGATTGCTCTTATTGTAGAGATGGTACGGAGA
CTGGCTGTAGAAAAGCTATTAGAGGAGAATATGGGAGGCAAATCACTTGTTTCCATCATGCTATTCAAAGGATTTGTTCCTGATGTAGTA
ACTTATAATTGTTTGATCAATGGATGCTGCAAAACTAATAGGATAGAGAGAGCATTGGAGTTGTTGGATGATATGGTGAAAAGAGGGGTT
GTGCCTAATCGAATTACATATAATTCTTTCATTAGGTATTATAGTGTTACAAATGAGATTGATAAGGCTATTGAAATGCTGAGAAGAATG
CAAGGAATGAATCATGGAGTAGTACTACCATGTAACAGTTCGTATACACCGATAATTCATGCTATGTGTGAAACTGGTAGGGTGGTGGAG
GCAAGAGATCTTCTTGTTGAAGTGGCTGAACAAGGTTCAATTCCAAGAGAATATACTTATAAACTAGTTCGTGATGCTTTAGAATCTTCT
GGGAAGATTGATTTGCTTGATGAAGAATTGTGTACAAGATTAGAAGATGGTATTAAAGGTAGGATTAGACAAGTGATGAAAGTTAAACCT
TTGTTGCAGCATCAAACTGTTTCATCGCATTAA
Edits in Original Sequence 
GGGGGAACTGATAAATTACATGGGATGGATTGAGCTTTTTTTGGCACCCCTAATTTCACTG(5')ATGGCGATCAATTACGATGGCTTGG
TTGATTATXATAATCTGAAAGtCTGAATATTTTTGCTCTGTGTTGTCATCAACATCACTTTCTGCTCCTTTCATCCAAAACCTTGTTATG
GATCAAGCTATGGCTGCTATTATCAGAAATCGGCCATTTGAGTCTTCAATTCCCCAATCCATTTGGACTGTAGAAACAGTTTCTCAAGTC
TTGaGATCAATCCCCAGATTCCTCTTCCAATCCCCAAGATCCATTGGCCGACAAAATGGGTTTCGCCACCGTaCCCCATTAAAGCAGAGA
AACCTAAAACAAGAGTTaCATAACGCTCGGAAGGGAGTACTCATTCTCGGACCGGCTGCTCATAGAGATGTTCAAAAGGTGCAATTAGGA
TTGGAGAAAGCATTGGaATTTTTCCATTGGGTTGAGACCCGCTGTGGGTTTACTCACAATGAGCTCACTTGTAGAGAAATGTCTCTTGTT
CTTGCCAAAGGGTCGTGTAATTcGAAGTTTCTTTGGGAATTTCTCAGAAGAATGTCGAGAAGAGGGCTTTTGACGACACCGACTGTTACG
TGTTTGATAAAATGCCTAGGAGAAGAAGGGTTGGTAAAtGAAGCATTGACTACTTTCTACAGAATGAAGCAATTTCACTGTATGCCTGAT
GTTTATGCTTACAACACACTCATATTTGCTCTTTGTAGAGTTGGGAATTTCAAAAAAGCTAAGTTCTTGATGGAGCAAATGGAGTTGCCT
GGTTTTAGGTGTCCACCCGATGTCTTTACTTACACAATCTTGATTaGCTCTTATTGTAGAGATGGTACGGAGACTGGCTGTAGAAAAGCT
ATTAGAcGGAGAATATGGGAGGCAAATCACTTGTTTCgCATCATGCTATTCAAAGGATTTGTTCCTGATGTAGTAACTTATAATTGTTTG
ATCAATGGATGCTGCAAAACTAATAGGATAGAGAGAGCATTGGAGTTGTTGGATGATATGGTGAAAAGAGGGGTTGTGCCTAATCGAATT
ACATATAATTCTTTCATTAGGTATTATAGTGTTACAAATGAGATTGATAAGGCTATTGAAATGCTGAGAAGAATGCAAGGAATGAATCAT
GGAGTAGTACTACCATGTAACAGTTCGTATACACCGATAATTCATGCTATGTGTGAAACTGGTAGGGTGGTGGAGGCAAGAGATCTTCTT
GTTGAAGTGGCTGAACAAGGTTCAATTCCAAGAGAATATACTTATAAACTAGTTCGTGATGCTTTAGAATCTTCTGGGAAGATTGATTTG
CTTGATGAAGAATTGTGTACAAGATTAGAAGATGGTATTAAAGGTAGGATTAGACAAGTGATGAAAGTTAAACCTTTGTTGCAGCATCAA
ACTGTTTCATCGCATTAA(3')ATTTTATACTTTTTATCTATGTTGCTCAGACTCTTCGAAAATGTTGATGGTTGTGTGTTGGATTCTCC
GAAAGTAGTGTATATTTGGAGAATTTGACACTGATGCAACATTGAAAGTGAAGAGTTCACACAACTTAAACTTTTTATGGATTTAGATCT
TATAAAAGCACAAGGGATTTAACTTATATACTGTTAGGCACTGCTGATACACGTGTTACGTCATAACGTAGCTTCTAGATGAGAAAAGAA
TGTTAGCAGTTTCAACTTTTTCTATCTAGTTGTTCTCTGCTTCTGCCATATCTTTATCACCGCCTTCATTTCTTTCTTCAATTTGAGCTT
CTTTGTTATCTCAGGTGAGATTTGAATTCATTGTCAGTGTTCTGTACTATTTTAATGATGTTATTGTGATGAAGCTTGTACAAATTAGGT
TTTAAGATCTACAGTATATGTCTGCGGATAAAAACTCAATGGTACTAACTTCTTAAATTGCTTGGTGAAGAGTTATATCCCGATGTGACC
TATAATTCATGGGTTAGAGCACTAAAATTAGTCATAGCTTACATTAGGATATATATTATTATTGGTCATAGCTTACATCATGAGTTTGAA
GTAGTAAATTAGTCATGCTTACATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan