ESTScan Details for Unigene SGN-U566978

Score 
710
Direction 
Forward
Predicted Peptide Sequence 
XMGRGSSMLLDEDDTDNEDDEEEEENGYKGFRDLIDSEEESEESDEDNEVEDEKMASLEEDSPRASSPSSHGKSDSHLTETRFDQFPLSP
LSLKGVKDAGYKTMTVVQEATLPIILKGKDVLAKAKTGTGKTVAFLLPSIEVVVKSPPNTRDQKRPPILVLVICPTRELATQAAAEANTL
LKYHPSIGVQVVIGGTRLALEQKRMQANPCQILVATPGRLRDHVENTAGFATRLMGVKVLVLDEADHLLDMGFPKKLRESSLLFPNSAKH
FSFX
Predicted Coding Sequence 
XXGATGGGTCGAGGTAGTTCCATGCTGTTGGATGAAGATGATACCGATAATGAGGATGACGAAGAGGAAGAGGAGAATGGTTATAAGGGG
TTCCGAGATTTGATTGACAGCGAGGAAGAAAGTGAAGAATCTGATGAAGACAATGAGGTCGAGGATGAAAAGATGGCCTCATTGGAGGAG
GACAGTCCAAGGGCATCAAGCCCGAGCTCACATGGAAAAAGTGATTCCCACCTCACCGAAACCAGGTTTGATCAGTTTCCTCTCTCTCCC
TTGTCTCTGAAAGGAGTTAAAGATGCTGGATACAAAACGATGACCGTAGTGCAGGAGGCAACCCTTCCCATTATTCTAAAAGGCAAGGAC
GTTCTGGCCAAGGCAAAGACTGGCACTGGGAAAACTGTAGCATTTTTGCTTCCTTCAATTGAAGTTGTTGTAAAATCACCCCCCAACACC
CGTGATCAAAAGAGGCCACCAATTCTGGTGCTTGTGATATGCCCTACCCGGGAGCTTGCAACTCAAGCAGCTGCCGAGGCCAACACCTTG
TTAAAATATCACCCTTCAATTGGGGTTCAAGTTGTTATAGGCGGAACAAGGCTTGCACTTGAGCAGAAAAGGATGCAAGCAAATCCATGT
CAGATACTTGTGGCGACACCTGGGAGACTCAGAGATCATGTAGAGAATACAGCAGGATTTGCTACTCGGTTGATGGGTGTTAAAGTGTTG
GTCCTTGATGAAGCCGATCATTTGTTGGATATGGGATTCCCGAAGAAATTGAGAGAATCATCTCTGCTATTCCCAAACAGCGCCAAACAC
TTCTCTTTTCXX
Edits in Original Sequence 
(5')XXGATGGGTCGAGGTAGTTCCATGCTGTTGGATGAAGATGATACCGATAATGAGGATGACGAAGAGGAAGAGGAGAATGGTTATAA
GGGGTTCCGAGATTTGATTGACAGCGAGGAAGAAAGTGAAGAATCTGATGAAGACAATGAGGTCGAGGATGAAAAGATGGCCTCATTGGA
GGAGGACAGTCCAAGGGCATCAAGCCCGAGCTCACATGGAAAAAGTGATTCCCACCTCACCGAAACCAGGTTTGATCAGTTTCCTCTCTC
TCCCTTGTCTCTGAAAGGAGTTAAAGATGCTGGATACAAAACGATGACCGTAGTGCAGGAGGCAACCCTTCCCATTATTCTAAAAGGCAA
GGACGTTCTGGCCAAGGCAAAGACTGGCACTGGGAAAACTGTAGCATTTTTGCTTCCTTCAATTGAAGTTGTTGTAAAATCACCCCCCAA
CACCCGTGATCAAAAGAGGCCACCAATTCTGGTGCTTGTGATATGCCCTACCCGGGAGCTTGCAACTCAAGCAGCTGCCGAGGCCAACAC
CTTGTTAAAATATCACCCTTCAATTGGGGTTCAAGTTGTTATAGGCGGAACAAGGCTTGCACTTGAGCAGAAAAGGATGCAAGCAAATCC
ATGTCAGATACTTGTGGCGACACCTGGGAGACTCAGAGATCATGTAGAGAATACAGCAGGATTTGCTACTCGGTTGATGGGTGTTAAAGT
GTTGGTCCTTGATGAAGCCGATCATTTGTTGGATATGGGATTCCCGtAAGAAATTGAGAGAATCATCTCTGCTATTCCCAAACAGCGCCA
AACACTTCTCTTTTCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan