Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U566989

Score 
126
Direction 
Reverse
Predicted Peptide Sequence 
IVIAHRLSTIQAADRIVVMESGKVVEMGSHKELLLNDGLYARLTRRQADAVDEFLHLTDIKVWVDXFGLQVPDWTVEMTWFFYFTKCLCT
RLNEPSEXKRTDNMGLVADLAVGTISNFQRDQVSFKDFAASLVKAITWWRGLRDVQYVQRVAETYTTKADTVDPCKCLETMSFWFNAEIE
RKPCS*
Predicted Coding Sequence 
ATTGTGATTGCACACCGGCTTTCGACAATACAAGCTGCTGACAGAATAGTTGTGATGGAAAGCGGAAAAGTTGTTGAGATGGGTAGCCAC
AAAGAGCTTCTCCTCAATGATGGCTTGTATGCTCGATTAACCAGAAGACAGGCTGATGCTGTGGATGAATTCTTGCATTTGACCGACATA
AAGGTTTGGGTTGATXTCTTTGGCCTACAAGTTCCTGATTGGACAGTAGAGATGACTTGGTTCTTTTATTTCACAAAATGCCTATGCACT
AGATTAAATGAACCTTCTGAAXTGAAGAGGACAGACAATATGGGATTAGTTGCAGATCTTGCAGTTGGXACCATCTCAAATTTTCAAAGG
GATCAGGTTAGCTTCAAAGATTTTGCTGCATCACTGGTCAAAGCTATAACTTGGTGGAGGGGTTTGCGTGATGTACAATATGTTCAAAGG
GTTGCAGAGACTTATACCACAAAAGCCGATACTGTTGATCCATGTAAATGTCTCGAAACCATGTCATTCTGGTTCAATGCTGAAATTGAA
AGAAAACCTTGCTCATAG
Edits in Original Sequence 
(5')ATTGTGATTGCACACCGGCTTTCGACAATACAAGCTGCTGACAGAATAGTTGTGATGGAAAGCGGAAAAGTTGTTGAGATGGGTAG
CCACAAAGAGCTTCTCCTCAATGATGGCTTGTATGCTCGATTAACCAGAAGACAGGCTGATGCTGTGGcATGAATTCTTGCATTTGACCG
ACATAAAGGTTTGGGTTGATXTCTTTGGCCTACtAAGTTCCTGATTGGACAGTAGAGATGACTTGGTaTCTTTTATTTCACAAAATGCCT
ATGCACTAGATTAAATaGAACCTTCTGAAXTGAAGAGGACAGACAATATGGGATTAGTTGCAGATCTTGCAGTTGGXACCATCTCAAATT
TTCtAAAGGGATCAGGTTAGCTTCAAAGATTTTGCTGCATCACTGGTCAAAGCTATAACTTGGTGGAGGGGTTTGCGTGATGTACAATAT
GTTCAAAGGGTTGCAGAGACTTATACCACAAAgAGCCGATACTGTTGATCCATGTAAATGTCTCGAAACCATGTCATTCTGGTTCAATGC
TGAAATTGAAAGAAAACCTTGCTCATAG(3')AGAAACATTTTGTTTGGAAAAATCACGCCACCACATCTATTTATTTAAGGGTTAATAT
TATAACTTTTAGATCTACTTTTCTTTTATAGTACTACTTATGTTATTTTAATTACAAGTGTTAACCAATTAGTTTTACATTTATATATCA
ATTAGGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan