ESTScan Details for Unigene SGN-U566990

Score 
701
Direction 
Forward
Predicted Peptide Sequence 
XKVPLMDTGTFXFNTLYHSTQVIAVLVGGISILAGHITAEQLTKFVLYSXMVDLFYMVGRGQFFVIDAIIGASEKVFQLMDLGSRDKFID
KGAKLEGLAGRIEFVNISFYYPSRVEVPVLQHINFVVHPGEVVALVGLSGSGKSTLVNLLLRLYEPISGQISIDGYPIRDLNIKWLRERI
GYVGQEPRLFRMDISSNIRYGCSRDVNQQDVEWAAKEAAAHDFISSLPNGFHTIVDNDLLSGGQKQRIAIARAILRDPDILVLDEATSAL
DAESEHNIKGVLCAVRRELKSKRTVIVIAHRVSTIQAAD
Predicted Coding Sequence 
XTCAAAGTGCCGCTTATGGATACTGGAACTTTTGXTTTCAACACACTTTATCACTCAACTCAGGTTATTGCTGTGCTGGTAGGAGGAATA
TCTATCCTGGCTGGTCATATTACTGCAGAACAACTTACCAAATTCGTATTATACAGTGAXATGGTTGATTTATTCTACATGGTGGGTAGG
GGACAATTTTTCGTCATTGATGCAATTATTGGGGCAAGTGAGAAGGTTTTTCAATTAATGGATCTCGGTTCTAGAGATAAATTCATTGAC
AAAGGAGCCAAGTTGGAAGGATTAGCAGGACGCATTGAATTTGTGAATATTAGTTTCTACTATCCTTCAAGAGTTGAGGTGCCAGTACTT
CAACATATTAACTTTGTGGTGCATCCCGGTGAAGTAGTAGCACTCGTTGGCCTAAGTGGTAGTGGAAAAAGCACTCTGGTGAACCTTCTC
CTTCGGCTGTATGAGCCAATAAGTGGGCAGATATCTATTGATGGCTACCCGATTAGAGATTTGAACATCAAGTGGTTGAGGGAAAGAATT
GGATATGTGGGACAGGAACCTAGACTTTTCCGCATGGATATCAGCTCAAACATAAGATATGGCTGTAGTAGAGATGTCAATCAACAAGAT
GTGGAATGGGCTGCCAAGGAGGCCGCTGCCCATGATTTTATTTCATCTCTACCCAATGGCTTCCACACAATTGTTGATAATGATTTGCTC
AGTGGAGGCCAGAAGCAGCGAATTGCAATTGCTAGAGCCATTCTTAGGGATCCAGATATTTTAGTACTTGATGAAGCCACTAGTGCTCTA
GATGCAGAGAGTGAACACAACATTAAAGGTGTGCTTTGTGCTGTCAGAAGAGAACTGAAATCAAAGAGAACTGTCATTGTGATTGCACAC
CGGGTTTCGACAATACAAGCTGCTGAC
Edits in Original Sequence 
(5')XTCAAAGTGCCGCTTATGGATACTGGAACTTTTGXTTTCAACACACTTTATCACTCAACTCAGGTTATTGCTGTGCTGGTAGGAGG
AATATCTATCCTGGCTGGTCATATTACTGCAGAACAACTTACCAAATTCGTATTATACAGTGAXATGGTTGATTTATTCTACATGGTGGG
TAGGGGACAATTTTTCGTCATTGATGCAATcTATTGGGGCAAGTGAGAAGGTTTTTCAATTAATGGATCTCGGTTCTAGAGATAAATTCA
TTGACAAAGGAGCCAAGTTGGAAGGATTAGCAGGACGCATTGAATTTGTGAATATTAGTTTCTACTATCCTTCAAGAGTTGAGGTGCCAG
TACTTCAACATATTAACTTTGTGGTGCATCCCGGTGAAGTAGTAGCACTCGTTGGCCTAAGTGGTAGTGGAAAAAGCACTCTGGTGAACC
TTCTCCTTCGGCTGTATGAGCCAATAAGTGGGCAGATATCTATTGATGGCTACCCGATTAGAGATTTGAACATCAAGTGGTTGAGGGAAA
GAATTGGATATGTGGGACAGGAACCTAGACTTTTCCGCATGGATATCAGCTCAAACATAAGATATGGCTGTAGTAGAGATGTCAATCAAC
AAGATGTGGAATGGGCTGCCAAGGAGGCCGCTGCCCATGATTTTATTTCATCTCTACCCAATGGCTTCCACACAATTGTTGATAATGATT
TGCTCAGTGGAGGCCAGAAGCAGCGAATTGCAATTGCTAGAGCCATTCTTAGGGATCCAGATATTTTAGTACTTGATGAAGCCACTAGTG
CTCTAGATGCAGAGAGTGAACACAACATTAAAGGTGTGCTTTGTGCTGTCAGAAGAGAACTGAAATCAAAGAGAACTGTCATTGTGATTG
CACACCGGGTTTCGACAATACAAGCTGCTGAC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan