ESTScan Details for Unigene SGN-U566998

Score 
740
Direction 
Forward
Predicted Peptide Sequence 
XLLSTFAKATVSASTSSSSYMKTFFPNFDLGKPLLLRSLTNRKDKWTVCACVAPPRDYKAADSDRVLNTKFNIRHGEAVGIIGPSGTGKS
TILKIMAGLLAPDKGEVLIRGKLRNGLVSDDEISGLRIGLVFQSAALFDSLTVRENVGFLLYENSAMPEDQIAQLVTETLAAVGLKEVED
RLPSELSGGMKKRVALARSIIFDTTKDVVEPEVLLYDEPTAGLDPIASTVVEDLIRSVHVAGEDALGKPGKIASYVVVTHQHSTIKRAVD
RLIFLYEGKVVWQGMTHEFSTSTNPIVRQFASGSLDGPIDISFCNQNKYKTYSVLLAALILPPAELGCFKADLVKATKKRSMPKEXVTLE
ALXFAEPAYMKCAS*
Predicted Coding Sequence 
XXCCTGTTGTCAACTTTTGCAAAAGCAACGGTGTCXGCTTCTACTTCTTCTTCTAGCTACATGAAAACATTTTTTCCCAATTTTGATTTA
GGAAAGCCATTATTGCTGCGTTCCCTGACGAATAGGAAGGATAAATGGACTGTTTGTGCTTGTGTTGCACCACCTCGGGACTACAAAGCT
GCTGATTCTGATAGGGTTCTCAATACAAAATTCAATATCAGACATGGTGAGGCTGTTGGAATTATTGGGCCTTCTGGCACAGGGAAATCA
ACAATCTTAAAGATAATGGCTGGCCTACTTGCTCCTGATAAAGGAGAAGTCTTAATCCGAGGTAAACTGCGTAATGGATTAGTGAGTGAT
GACGAAATTTCTGGGCTTAGGATTGGCTTAGTGTTTCAGAGTGCTGCGCTTTTTGATTCATTAACTGTTCGTGAAAATGTTGGTTTCTTG
CTATATGAGAATTCAGCTATGCCAGAGGATCAAATTGCACAGCTTGTAACCGAAACTTTAGCTGCTGTTGGTTTGAAGGAAGTTGAAGAC
CGATTACCCTCTGAATTGTCTGGTGGTATGAAGAAAAGAGTTGCTCTAGCTCGTTCTATAATTTTTGATACCACCAAAGACGTAGTAGAG
CCAGAGGTGCTCTTGTATGATGAACCAACAGCTGGACTTGATCCGATTGCATCAACCGTTGTAGAAGATCTCATTCGCTCGGTTCACGTG
GCAGGCGAGGATGCACTTGGGAAGCCTGGGAAGATTGCATCATATGTTGTTGTCACACATCAACACAGTACTATTAAAAGAGCTGTCGAC
AGGCTAATATTTCTTTATGAAGGTAAGGTTGTCTGGCAGGGAATGACTCATGAGTTCTCCACATCAACTAATCCTATTGTTCGGCAGTTT
GCATCAGGGAGTTTGGATGGTCCTATTGATATTAGCTTCTGCAACCAAAACAAATACAAAACGTACTCAGTCTTACTCGCAGCGTTGATT
TTACCACCAGCTGAACTTGGGTGCTTCAAGGCTGACCTTGTCAAAGCAACAAAAAAGAGATCAATGCCTAAAGAGXTAGTCACACTTGAA
GCTCTTXATTTTGCTGAGCCTGCTTACATGAAGTGCGCGTCATAG
Edits in Original Sequence 
(5')XXCCTGTTGTCAACTTTTGCAAAAGCAACGGTGTCXGCTTCTACTTCTTCTTCTAGCTACATGAAAACATTTTTTCCCAATTTTGA
TTTAGGAAAGCCATTATTGCTGCGTTCCCTGACGAATAGGAAGGATAAATGGACTGTTTGTGCTTGTGTTGCACCACCTCGGGACTACAA
AGCTGCTGATTCTGATAGGGTTCTCAATACAAAATTCAATATCAGACATGGTGAGGCTGTTGGAATTATTGGGCCTTCTGGCACAGGGAA
ATCAACAATCTTAAAGATAATGGCTGGCCTACTTGCTCCTGATAAAGGAGAAGTCTTAATCCGAGGTAAACTGCGTAATGGATTAGTGAG
TGATGACGAAATTTCTGGGCTTAGGATTGGCTTAGTGTTTCAGAGTGCTGCGCTTTTTGATTCATTAACTGTTCGTGAAAATGTTGGTTT
CTTGCTATATGAGAATTCAGCTATGCCAGAGGATCAAATTGCACAGCTTGTAACCGAAACTTTAGCTGCTGTTGGTTTGAAGGAAGTTGA
AGACCGATTACCCTCTGAATTGTCTGGTGGTATGAAGAAAAGAGTTGCTCTAGCTCGTTCTATAATTTTTGATACCACCAAAGACGTAGT
AGAGCCAGAGGTGCTCTTGTATGATGAACCAACAGCTGGACTTGATCCGATTGCATCAACCGTTGTAGAAGATCTCATTCGCTCGGTTCA
CGTGGCAGGCGAGGATGCACTTGGGAAGCCTGGGAAGATTGCATCATATGTTGTTGTCACACATCAACACAGTACTATTAAAAGAGCTGT
CGACAGGCTAATATTTCTTTATGAAGGTAAGGTTGTCTGGCAGGGAATGACTCATGAGTTCTCCACATCAACTAATCCTATTGTTCGGCA
GTTTGCATCAGGGAGTTTGGATGGTCCTATTaGATATTAGCTTCTGCAACCAAAACAAATACAAAACGTACTCAGTCTTACTCGCAGCGT
TGATTTTACCtACCAGCTGAACTTGGGTGCTTCAAGGCTGACCTTGTCAAAGCAACAAAAAAGAGATCAATGCCTAAAGAGXTAGTCACA
CTTGAAGCTCTTXATTTTGCTGAGCCTGCTTACATGAAtGTGCGCGTCATAG(3')AAGGGAGTTTCTGGTTTTATTTTACTCTTGTTCT
TCCCTCTTATTTGTTTTTCACATTCATCTTTGTAACTGGTCTCTTATCATTTTTAATGCTAGCAACTTGATAGTAAGGTGTCTCATGTTA
AAATGAATTGATTAGTAATCGATTGTGTAACATAATAAGTGATTCATATTAAATGTGGAAATTAACGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan