ESTScan Details for Unigene SGN-U567042

Score 
440
Direction 
Forward
Predicted Peptide Sequence 
XVQEISAKGIEPPSEFFVKDTILAGNXKLYFIDPNTDHRSEFAFIDPNSEAYKDEINKLLDALSSWGVCXGNRSWDVKYHIWRKYXNVIK
KFFCLSNEEKQKYSRAADGFEGYGNDPIFVEGQVLDWCDRLFLTAYPQDQRNLQFWPQNPPNFMNVFEEYCNKVIVLTRTLLKIFARSQN
LEDDAFYKEIGEKTLX
Predicted Coding Sequence 
XXGGTTCAAGAGATTTCTGCGAAAGGAATAGAACCTCCATCGGAGTTTTTCGTTAAGGATACTATTCTTGCTGGAAATXTTAAGCTCTAT
TTCATAGATCCAAATACCGATCATCGATCTGAATTTGCTTTTATTGATCCCAATTCTGAAGCATACAAGGATGAAATCAACAAACTGCTA
GATGCTCTCAGCTCTTGGGGTGTTTGTCAXGGTAATAGGTCATGGGATGTCAAGTATCATATTTGGAGGAAATACATXAACGTCATCAAG
AAATTCTTTTGTCTATCAAATGAAGAGAAGCAAAAATATAGTAGAGCTGCTGATGGATTTGAAGGATATGGAAATGACCCAATTTTTGTT
GAAGGACAAGTTTTAGATTGGTGTGATCGATTGTTTTTGACAGCATACCCTCAAGATCAAAGAAATCTTCAATTTTGGCCTCAAAATCCT
CCTAATTTTATGAATGTCTTTGAAGAATATTGTAATAAGGTGATAGTATTAACAAGAACTTTGCTAAAAATATTTGCAAGATCACAAAAC
TTGGAGGATGATGCTTTCTATAAAGAGATTGGAGAAAAAACATTGGXX
Edits in Original Sequence 
(5')XXGGTTCAAGAGATTTCTGCGAAAGGAATAGAACCTCCATCGGAGTTTTTCGTTAAGGATACTATTCTTGCTGGAAATXTTAAGCT
CTATTTCATAGATCCAAATACCGATCATCGATCTGAATTTGCTTTTATTgGATCCCAATTCTGAAGCATACAAGGATGAAATCAACAAAC
TGCTAGATGCTCTCAGCTCTTGGGGTGTTTGTCAXGGTAATAGGTCATGGGATGTCAAGTATCATATTTGGAGGAAATACATXAACGTCA
TCAAGAAATTCTTTTGTCTATCAAATGAAGAGAAGCAAAAATATAGTAGAGCTGCTGATGGATTTGAAGGATATGGAAATGACCCAATTT
TTGTTGAAGGACAAGTTTTAGATTGGTGTGATCGATTGTTTTTGACAGCATACCCTCAAGATCAAAGAAATCTTCAATTTTGGCCTCAAA
ATCCTCCTAATTTTATGAATGTCTTTGAAGAATATTGTAATAAGGTGATAGTATTAACAAGAACTTTGCTAAAAATATTTGCAAGATCAC
AAAACTTGGAGGATGATGCTTTCTATAAAGAGATTGGAGAAAAAACATTGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan