ESTScan Details for Unigene SGN-U567149

Score 
629
Direction 
Reverse
Predicted Peptide Sequence 
XVFEGCLADGTKIAVKCLDGIGQVKTSFLAEVETIGSIHHXKLGAIDWLLAEKSHRLLVYECMSNGSTRKMDLPGKQEQTLDWNCRRKII
QDIAKGLAYLHEECRQKILHLDIKPPNILLDEKYNAKLADFGLSKLIDRNQSQVMTQMRGTPGYLAPEWLSGVITEKVDVYSFGIVILEI
LSGRRHFEALESEDEQVMVNLFRRKAEEGQLVDLIDKHSEDMQFYKEEVVKAMQIAAWCLQSDYTKRPSMSMVVKAMEGVIDVGKDLDYS
FRPQTVSAIPNICFADSAPXTAFGPIRP*
Predicted Coding Sequence 
XXGGTTTTTGAAGGGTGCTTAGCGGATGGCACAAAGATTGCAGTGAAATGCCTTGATGGAATAGGACAAGTCAAAACGTCATTCTTAGCT
GAGGTTGAAACTATTGGCAGCATACATCATGXTAAACTTGGTGCAATTGATTGGCTTCTGGCTGAGAAATCTCACAGGCTTTTAGTATAT
GAGTGCATGAGCAACGGATCAACTAGAAAAATGGATCTACCCGGGAAACAGGAGCAAACTCTAGACTGGAACTGCAGGAGGAAGATTATT
CAAGACATAGCCAAAGGATTAGCCTACCTTCACGAAGAATGCAGGCAAAAGATTCTGCATTTGGATATTAAGCCCCCAAACATACTCCTG
GATGAGAAGTACAATGCTAAACTCGCTGACTTTGGGCTTTCAAAGCTAATTGATCGGAATCAGAGCCAAGTTATGACTCAGATGAGAGGC
ACTCCTGGTTATTTGGCTCCTGAATGGCTTAGTGGAGTTATAACAGAGAAGGTAGACGTCTATAGCTTTGGCATTGTGATCTTGGAAATT
TTGAGTGGAAGAAGACATTTTGAAGCATTGGAGTCTGAAGACGAACAGGTAATGGTGAACTTATTCAGGAGAAAAGCAGAGGAAGGGCAG
TTGGTTGATCTTATTGATAAGCACAGTGAAGATATGCAGTTTTACAAAGAAGAAGTAGTCAAGGCAATGCAGATTGCTGCCTGGTGTTTA
CAAAGTGATTACACGAAGAGGCCATCAATGTCGATGGTGGTCAAGGCCATGGAGGGTGTTATAGATGTTGGCAAGGATCTAGACTACAGC
TTTAGACCACAAACTGTTTCCGCAATACCAAATATCTGTTTTGCAGATTCAGCTCCTXTTACTGCCTTCGGTCCTATCAGGCCCTAG
Edits in Original Sequence 
(5')XXGGTTTTTGAAGGGTGCTTAGCGGATGGCACAAAGATTGCAGTGAAATGCCTTGATGGAATAGGACAAGTCAAAACGTCATTCTT
AGCTGAGGTTGAAACTATTGGCAGCATACATCATGXTAAACTTGGTGCAATTGATTGGCTTCTGcGCTGAGAAATCTCACAGGCTTTTAG
TATATGAGTGCATGAGCAACGGATCAACTAGAAAAATGGATCTACCaCGGGAAACAGGAGCAAACTCTAGACTGGAACTGCAGGAGGAAG
ATTATTCAAGACATAGCCAAAGGATTAGCCTACCTTCACGAAGAATGCAGGCAAAAGATTCTGCATTTGGATATTAAGCCCCCAAACATA
CTCCTGGATGAGAAGTACAATGCTAAACTCGCTGACTTTGGGCTTTCAAAGCTAATTGATCGGAATCAGAGCCAAGTTATGACTCAGATG
AGAGGCACTCCTGGTTATTTGGCTCCTGAATGGCTTAGTGGAGTTATAACAGAGAAGGTAGACGTCTATAGCTTTGGCATTGTGATCTTG
GAAATTTTGAGTGGAAGAAGACATTTTGAAGCATTGGAGTCTGAAGACGAACAGGTAATGGTGAACTTATTCAGGAGAAAAGCAGAGGAA
GGGCAGTTGGTTGATCTTATTGATAAGCACAGTGAAGATATGCAGTTTTACAAAGAAGAAGTAGTCAAGGCAATGCAGATTGCTGCCTGG
TGTTTACAAAGTGATTACACGAAGAGGCCATCAATGTCGATGGTGGTCAAGGCCATGGAGGGTGTTATAGATGTTGGCAAGGATCTAGAC
TACAGCTTTAGACCACAAACTGTTTCCGCAATACCAAATATCTGTTTTGCAGATTCAGCTCCTXTTACTGCCTTCGGTCCTATCAGGCCC
TAG(3')GTGAGGAGGAAGTTCCTTGGAATTTTTGTATTTTTCTTGTTTTTATGCTATTGCAGCTTGTTTGCTGCTGTGTCAATTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan