ESTScan Details for Unigene SGN-U567462

Score 
200
Direction 
Forward
Predicted Peptide Sequence 
LPVQFHRPAAKVSGSAPLTLEAQKLLIMAALPYADVDSSLKALAGRAEGFGRFAIGGLNGPVYSVTTLADDGPGSLRDGCRKKEPLWIVF
EVSGTIPLTSYLRVSSHKTIDGRGQRIILTGKGLQLKDCEHIIVCNLEFEGGRGHDVDGIQIKPNSRHIWIDRCSLRDYDDGLIDITRQS
TDITISRCYFAQHDKTMLIGADPSHVGDRCIRVTIHHCFFDGTRQRQPRVRFGKVHLYNNYTRNWGIYAICASVESQIYSQCNIYEASQK
KKAFEYYTEKAADKEEARSGLIRSEGDMFLNGAQGSLLTGIGGECVFHPSEFYPVWTLEPASDSLKGILHICTGWQSVSLPQEECARQLK
PAASXPPETDLVLVTGLSEPSNFGSNLVCIKQFTKXSTNNIXILRSRIQNRFWINFQSQSRSNLGSPRDFFYRLAQCSNLGSTSVFFTNW
LNVQILDLPA*
Predicted Coding Sequence 
CTTCCGGTTCAATTTCACCGGCCGGCGGCTAAAGTTTCCGGTTCAGCCCCCTTAACCCTAGAAGCTCAGAAATTGCTGATCATGGCGGCG
TTGCCATATGCTGATGTCGATTCGAGCTTAAAAGCTCTAGCCGGTCGAGCCGAAGGATTTGGCAGATTTGCAATCGGCGGTCTAAATGGT
CCGGTCTATTCCGTCACAACATTGGCCGATGATGGTCCGGGATCACTCCGTGATGGATGCCGTAAGAAAGAACCACTATGGATTGTTTTT
GAAGTTTCAGGCACCATTCCTCTCACGTCTTACCTACGTGTGTCATCCCATAAAACTATTGATGGTCGTGGACAAAGGATAATACTCACT
GGCAAAGGCTTACAGCTGAAGGATTGTGAGCACATAATCGTATGCAATTTGGAGTTTGAAGGTGGCAGAGGTCATGATGTTGACGGCATT
CAGATAAAACCAAATTCCAGGCACATTTGGATAGACCGCTGTTCTCTTCGTGATTATGATGATGGGCTAATCGATATTACCAGACAAAGC
ACAGATATAACTATTTCTAGATGTTATTTTGCTCAGCATGATAAGACAATGCTTATTGGAGCAGACCCGTCTCATGTTGGTGATAGATGT
ATCAGAGTGACCATCCACCATTGCTTTTTCGATGGGACGAGGCAGAGGCAACCTCGTGTTAGATTTGGTAAAGTTCATCTGTACAACAAT
TACACTAGAAATTGGGGTATATATGCTATTTGTGCTAGTGTAGAATCACAGATATATTCTCAATGCAACATATATGAAGCTTCACAGAAG
AAAAAAGCTTTCGAATACTACACAGAGAAGGCAGCAGATAAGGAGGAAGCAAGAAGTGGTTTAATCAGATCAGAAGGGGACATGTTTCTG
AATGGAGCTCAAGGGAGTTTGTTAACTGGTATTGGTGGAGAGTGTGTTTTTCATCCAAGTGAATTTTACCCTGTCTGGACACTGGAACCA
GCCTCAGACTCTCTCAAAGGTATTCTCCACATTTGCACTGGTTGGCAATCTGTTTCCCTTCCACAGGAGGAGTGTGCTCGTCAACTGAAA
CCCGCCGCTAGTXTTCCTCCCGAGACAGATCTAGTGCTCGTTACGGGTTTATCTGAACCTAGTAACTTTGGCTCAAACCTTGTATGTATT
AAACAGTTCACTAAAXTAAGTACAAATAATATTXATATCTTGAGATCCCGTATACAAAATAGGTTTTGGATAAATTTCCAATCTCAATCC
CGTTCAAATCTTGGATCTCCTCGGGATTTCTTCTACAGACTGGCTCAATGTTCAAATCTTGGATCTACCTCTGTTTTCTTCACCAACTGG
CTCAATGTTCAAATCTTGGATCTACCTGCGTAG
Edits in Original Sequence 
(5')CTTCCGGTTCAATTTCACCGGCCGGCGGCTAAAGTTTaCCGGTTCAGCCCCCTTAACCCTAGAAGCTCAGtAAATTGCTGATCATG
GCGGCGTTGCCATATGCTGATGTCGATTCGAGCTTAAAAGCTCTAGCCGGTCGAGCCGAAGGATTTGGCAGATTTGCAATCGGCGGTCTA
AATGGTCCGGTCTATTCCGTCACAACATTGGCCGATGATGGTCCGGGATCACTCCGTGATGGATGCCGTAAGAAAGAACCACTATGGATT
GTTTTTGAAGTTTCAGGCACCATTCCTCTCACGTCTTACCTACGTGTGTCATCCCATAAAACTATTGATGGTCGTGGACAAAGGATAATA
CTCACTGGCAAAGGCTTACAGCTGAAGGATTGTGAGCACATAATCGTATGCAATTTGGAGTTTGAAGGTGGCAGAGGTCATGATGTTGAC
GGCATTCAGATAAAACCAAATTCCAGGCACATTTGGATAGACCGCTGTTCTCTTCGTGATTATGATGATGGGCTAATCGATATTACCAGA
CAAAGCACAGATATAACTATTTCTAGATGTTATTTTGCTCAGCATGATAAGACAATGCTTATTGGAGCAGACCCGTCTCATGTTGGTGAT
AGATGTATCAGAGTGACCATCCACCATTGCTTTTTCGATGGGACGAGGCAGAGGCAACCTCGTGTTAGATTTGGTAAAGTTCATCTGTAC
AACAATTACACTAGAAATTGGGGTATATATGCTATTTGTGCTAGTGTAGAATCACAGATATATTCTCAATGCAACATATATGAAGCTTCA
CAGAAGAAAAAAGCTTTCGAATACTACACAGAGAAGGCAGCAGATAAGGAGGAAGCAAGAAGTGGTTTAATCAGATCAGAAGGGGACATG
TTTCTGAATGGAGCTCAAGGGAGTTTGTTAACTGGTATTGGTGGAGAGTGTGTTTTTCATCCAAGTGAATTTTACCCTGTCTGGACACTG
GAACCAGCCTCAGACTCTCTCAAAGGTATTCTCCACATTTGCACTGGTTGGCAATCTGTTTCCCTTCCACAGGAGGAGTGTGCTCGTCAA
CTGAAACCCGCaCGCTAGTXTTCCTCCCGAGACAGATCTAGTGCTCGTTACGGGTTTATCTGAACCTAGTAACTTTGGCTCAAACCTTGT
ATGTATTAAACAGTTCACTAAAXTAAGTACAAATAATATTXATATCTTGAGATCCCGTATACAAAATAGGTTTTGGATAAATTTCCAATC
TCAATCCCGTTCAAATCTTGGATCTaCCTCGGGATTTCTTCTACAGACTGGCTCAATGTTCAAATCTTGGATCTACCTCTGTTTTCTTCt
ACCAACTGGCTCAATGTTCAAATCTTGGATCTACCTGCGTAG(3')ATAGAGGAAGGGAGATTTATTGAATGCTTTTTCGGACATTTATC
GAGTTAGCAAGTTATTATTTTTGTAAGAATCGCTCTTTGATATAATAAACTTTCAAGTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan