ESTScan Details for Unigene SGN-U567536

Score 
409
Direction 
Forward
Predicted Peptide Sequence 
AKPLFVPIPFFPAPIQTLNLSKAVSDRRLDSEQSRKRMIDRCMLAGKYGEVDFDARVTDGLPLAEGLDDGRDVQNADFYKQQVKALFKNL
SMRQNDASRMSIETGPYVFHYIIEGHVCYLTMCDRSYPKKLAFQYLEDLKNEFERANGSQIETAARPYAFIKFDTFIQKTKKLYQDTRTQ
RNISKLNDELYEVHQIMTRNVQEVLGVGEKLDQVSQMSSRLTSESRIYADKAKDLNRQALIRKWAPVAIVLGVVFSSSGSEQRSGDASIQ
MQLSDDNTVKCFIHICHHQTLHNPENHLTYSYPACVVPYQFYSVKEERNRDEXMSLNLEKLH*
Predicted Coding Sequence 
GCAAAACCCCTCTTTGTTCCTATCCCATTTTTCCCAGCTCCGATTCAAACTCTTAACTTATCAAAGGCGGTCAGCGATCGGCGACTGGAT
TCCGAGCAGTCACGCAAGCGTATGATCGATCGCTGTATGCTTGCGGGAAAATATGGTGAAGTTGACTTTGATGCTCGCGTGACTGATGGC
CTTCCTTTAGCCGAGGGGCTGGATGATGGTCGTGATGTTCAAAATGCAGATTTCTACAAACAGCAGGTCAAGGCCTTATTCAAGAACCTG
TCGATGCGCCAAAATGACGCTTCAAGGATGTCTATTGAAACTGGACCTTACGTCTTCCATTATATCATTGAAGGGCATGTTTGTTATCTG
ACAATGTGTGATCGCTCTTATCCCAAGAAACTTGCCTTTCAATACCTGGAAGACCTTAAGAATGAGTTTGAGCGCGCCAATGGGAGTCAA
ATTGAAACTGCTGCTAGACCATATGCTTTTATTAAATTTGATACATTCATACAGAAGACGAAGAAACTGTACCAGGATACTAGAACTCAA
CGCAACATTTCTAAGTTGAATGATGAGCTTTACGAAGTTCATCAAATAATGACTCGAAATGTTCAAGAAGTTCTTGGAGTTGGTGAAAAG
TTGGACCAGGTCAGTCAAATGTCCAGCCGTTTGACATCTGAATCCCGGATATATGCTGATAAAGCAAAAGACTTAAATCGTCAGGCTTTG
ATTCGAAAATGGGCTCCTGTTGCTATTGTGCTTGGAGTTGTCTTCTCTTCTTCTGGCTCAGAACAAAGATCTGGTGATGCTTCCATACAG
ATGCAGCTCAGTGACGACAATACTGTCAAATGTTTTATTCATATTTGTCACCATCAGACTCTGCACAACCCAGAGAACCACCTCACTTAC
AGTTATCCAGCATGTGTTGTGCCATATCAGTTTTATAGTGTAAAAGAGGAAAGGAACCGCGATGAAXTTATGTCCCTTAACCTTGAGAAA
TTACATTAA
Edits in Original Sequence 
(5')GCAAAACCCCTCTTTGTTCCTATCCCATTTaTTCCCAGCTCCGATTCAAACTCTTAACTTATCAAAGGCGGTCAGCGATCGGCGAC
TGGATTCCGAGCAGTCACGCAAGCGTATGATCGATCGCTGTATGCTTGCGGGAAAATATGGTGAAGTTGACTTTGAtTGCTCGCGTGACT
GATGGCCTTCCTTTAGCCGAGGGGCTGGATGATGGTCGTGATGTTCAAAATGCAGATTTCTACAAACAGCAGGTCAAGGCCTTATTCAAG
AACCTGTCGATGCGCCAAAATGACGCTTCAAGGATGTCTATTGAAACTGGACCTTACGTCTTCCATTATATCATTGAAGGGCATGTTTGT
TATCTGACAATGTGTGATCGCTCTTATCCCAAGAAACTTGCCTTTCAATACCTGGAAGACCTTAAGAATGAGTTTGAGCGCGCCAATGGG
AGTCAAATTGAAACTGCTGCTAGACCATATGCTTTTATTAAATTTGATACATTCATACAGAAGACGAAGAAACTGTACCAGGATACTAGA
ACTCAACGCAACATTTCTAAGTTGAATGATGAGCTTTACGAAGTTCATCAAATAATGACTCGAAATGTTCAAGAAGTTCTTGGAGTTGGT
GAAAAGTTGGACCAGGTCAGTCAAATGTCCAGCCGTTTGACATCTGAATCCCGGATATATGCTGATAAAGCAAAAGACTTAAATCGTCAG
GCTTTGATTCGAAAATGGGCTCCTGTTGCTATTGTGCTTGGAGTTGTCaTTCTCTTCTTCTGGCTCAGAACAAAGATCTGGTGATGCTTC
CATACAGATGCAGCTCAGTGACGACAATACTGTCAAATGTTTTATTCATATTTGTCACCATCAGACTCTGCACAACCCAGAGAACCACCT
CACaTTACAGTTATCCAGCATGTGTTGTGCCATATCAGTTTTATAGTGTAAAAGAGGAAAGGAACCGCGATGAAXTTATGTCCCTTAACC
TTGAGAAATTACATTAA(3')TTTTGGCTCTCTTTTATATATTGTCTTGTTAGTTTAGCTTCAAAACTCCAACAAGTAGCTCATTGTAGT
TTCAGCTATGAAACTAACTTATTTCAGAATATACAGCAAATATAAACAATCCTTCAGACTGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan