ESTScan Details for Unigene SGN-U567573

Score 
1073
Direction 
Forward
Predicted Peptide Sequence 
XGKESIRVWEWLQLAWWCSTPFFISGEETGDFEAVMFVDTLKKQCNFSICSSSVHDLFVGVGVGLPCTVMECGDIIYRSTLPKSNGITVT
VPGVILALGTLSYLWATPGVAPGFFDMFVLAFIERFFRPIYKKDDIVLGKKLGEGSFGSVYRVSLARKPSSKPADLVLKKATEYGAVEIW
MNERVRRACANSCADFLYGFRETSSKKGAEYWLLWRFEGEATLADLMQSRDFPYNVESLILREVQDLPKGLDRQNRIILTIMKQLLFALD
GLHSTGIVHRDIKPQNIIFSEGSRAFKIIDLGAAADLRVGINYIPKEFLLDPRYAAPEQYIMSTQTPSAPSAPVATALSPVLWQLNLPDR
FDIYSVGLIFLQMAFPGLRSDNSLIQFNRQLKRCDYDLVSWRQSVEPRAGPELRKGFELLDLDGGIGWELLTSMVRFKARQRISAKTALA
HPYFDREGLLALSFIQNLKLQFLRATQQDYSEAANWVVQLMAKSGTEQDGGFTEAQLQQLREIEPKKKSNAQRNALASALRLQRKIIKTL
NESMDDLAINGKAYGGADGFQERNEISKCVQK*
Predicted Coding Sequence 
XGGGGTAAAGAAAGCATAAGAGTTTGGGAATGGCTGCAGTTGGCATGGTGGTGTAGTACTCCATTCTTCATTTCTGGGGAAGAAACTGGG
GATTTTGAAGCCGTTATGTTTGTCGATACATTGAAGAAACAATGTAATTTTTCAATTTGCAGTAGCTCTGTACATGATCTTTTTGTTGGA
GTTGGGGTAGGACTACCCTGTACTGTAATGGAGTGTGGTGATATAATTTATAGAAGCACACTACCCAAGTCAAATGGGATCACAGTTACA
GTTCCTGGGGTTATTTTGGCTTTGGGTACCCTCTCTTACCTCTGGGCTACTCCTGGTGTTGCTCCTGGTTTCTTTGATATGTTTGTTCTT
GCCTTTATTGAAAGATTCTTTCGACCTATTTATAAGAAGGATGATATTGTATTGGGAAAGAAACTTGGTGAGGGATCTTTTGGTTCTGTT
TATAGAGTTTCTTTGGCAAGAAAGCCATCATCAAAGCCTGCTGATTTAGTCTTAAAAAAGGCAACTGAATATGGAGCAGTGGAAATATGG
ATGAATGAGCGTGTGCGTAGAGCTTGTGCTAATAGTTGTGCTGATTTTCTTTATGGTTTTCGAGAGACTTCTTCAAAGAAAGGAGCAGAG
TATTGGCTTCTTTGGCGTTTCGAAGGGGAAGCTACACTTGCTGATTTGATGCAGAGTAGAGACTTTCCCTACAATGTAGAATCATTGATC
CTTCGAGAGGTTCAGGACTTGCCCAAAGGTTTGGATAGACAAAATAGAATCATTTTGACAATTATGAAACAACTCCTATTTGCTTTGGAT
GGGCTTCACTCCACAGGGATAGTACATAGAGATATTAAGCCTCAAAACATAATTTTCTCTGAAGGTTCTCGCGCGTTCAAAATAATTGAT
CTTGGTGCTGCAGCAGATTTGAGAGTAGGAATCAATTATATTCCTAAGGAGTTTCTTTTAGATCCAAGATACGCTGCACCAGAGCAATAC
ATTATGAGCACACAAACCCCTTCCGCACCGTCTGCTCCAGTTGCAACTGCACTGTCCCCAGTACTCTGGCAGCTGAATCTCCCAGATCGA
TTTGACATCTACAGTGTCGGTCTCATATTCCTGCAAATGGCATTCCCAGGATTACGCAGTGACAACAGTCTCATTCAATTCAACCGACAA
CTGAAGAGATGCGACTATGATTTAGTTTCGTGGAGACAGAGTGTAGAGCCTCGTGCTGGCCCTGAACTTAGGAAAGGCTTCGAGTTGTTA
GATTTGGATGGTGGAATAGGGTGGGAGCTATTAACATCTATGGTACGTTTCAAAGCACGCCAAAGAATTAGTGCAAAGACAGCTTTAGCA
CATCCATACTTTGATAGAGAAGGTCTTCTAGCCCTGTCCTTCATTCAGAACCTAAAGCTGCAATTCTTGCGGGCAACACAACAAGACTAT
AGTGAAGCTGCAAACTGGGTTGTTCAACTAATGGCAAAATCAGGAACAGAACAAGATGGGGGCTTCACGGAAGCACAACTTCAGCAGCTT
AGGGAAATAGAGCCTAAGAAGAAGTCAAATGCGCAGAGGAATGCTCTTGCATCAGCTCTTCGACTTCAAAGGAAAATTATAAAAACCCTG
AATGAGAGTATGGATGATCTTGCAATAAACGGAAAAGCTTATGGTGGAGCCGATGGATTCCAAGAGAGGAATGAAATTAGTAAATGTGTA
CAAAAATAG
Edits in Original Sequence 
(5')XGGGGTAAAGAAAGCATAAGAGTTTGGGAATGGCTGCAGTTGGCATaGGTGGTGTAGTACTCCATTCTTCATTTCTGGGGAAGAAA
CTGGGGATTTTGAAGCCGTTATGTTTGTCGATACgATTGAAGAAACAATGTAATTTTTCAATTTGCAGTAGCTCTGTACATGATCTTTTT
GTTGGAGTTGGGGTAGGACTACCCTGTACTGTAATGGAGTGTGGTGATATAATTTATAGAAGCACACTACCCAAGTCAAATGGGATCACA
GTTACAGTTCCTGGGGTTATTTTGGCTTTGGGTACCCTCTCTTACCTCTGGGCTACTCCTGGTGTTGCTCCTGGTTTCTTTGATATGTTT
GTTCTTGCCTTTATTGAAAGATTCTTTCGACCTATTTATAAGAAGGATGATATTGTATTGGGAAAGAAACTTGGTGAGGGATCTTTTGGT
TCTGTTTATAGAGTTTCTTTGGCAAGAAAGCCATCATCAAAGCCTGCTGATTTAGTCTTAAAAAAGGCAACTGAATATGGAGCAGTGGAA
ATATGGATGAATGAGCGTGTGCGTAGAGCTTGTGCTAATAGTTGTGCTGATTTTCTTTATGGTTTTCGAGAGACTTCTTCAAAGAAAGGA
GCAGAGTATTGGCTTCTTTGGCGTTTCGAAGGGGAAGCTACACTTGCTGATTTGATGCAGAGTAGAGACTTTCCCTACAATGTAGAATCA
TTGATCCTTCGAGAGGTTCAGGACTTGCCCAAAGGTTTGGATAGACAAAATAGAATCATTTTGACAATTATGAAACAACTCCTATTTGCT
TTGGATGGGCTTCACTCCACAGGGATAGTACATAGAGATATTAAGCCTCAAAACATAATTTTCTCTGAAGGTTCTCGCGCGTTCAAAATA
ATTGATCTTGGTGCTGCAGCAGATTTGAGAGTAGGAATCAATTATATTCCTAAGGAGTTTCTTTTAGATCCAAGATACGCTGCACCAGAG
CAATACATTATGAGCACACAAACCCCTTCCGCACCGTCTGCTCCAGTTGCAACTGCACTGTCCCCAGTACTCTGGCAGCTGAATCTCCCA
GATCGATTTGACATCTACAGTGTCGGTCTCATATTCCTGCAAATGGCATTCCCAGGATTACGCAGTGACAACAGTCTCATTCAATTCAAC
CGACAACTGAAGAGATGCGACTATGATTTAGTTTCGTGGAGACAGAGTGTAGAGCCTCGTGCTGGCCCTGAACTTAGGAAAGGCTTCGAG
TTGTTAGATTTGGATGGTGGAATAGGGTGGGAGCTATTAACATCTATGGTACGTTTCAAAGCACGCCAAAGAATTAGTGCAAAGACAGCT
TTAGCACATCCATACTTTGATAGAGAAGGTCTTCTAGCCCTGTCCTTCATTCAGAACCTAAAGCTGCAATTCTTGCGGGCAACACAACAA
GACTATAGTGAAGCTGCAAACTGGGTTGTTCAACTAATGGCAAAATCAGGAACAGAACAAGATGGGGGCTTCACGGAAGCACAACTTCAG
CAGCTTAGGGAAATAGAGCCTAAGAAGAAGTCAAATGCGCAGAGGAATGCTCTTGCATCAGCTCTTCGACTTCAAAGGAAAATTATAAAA
ACCCTGAATGAGAGTATGGATGATCTTaGCAATAAACGGAAAAGCTTATGGTGGAGCCGATGGATTCCAAGAGAGGAATGAAATTAGTAA
ATGTGTACAAAAATAG(3')CTTTAGTACTTTGTTTCATAGGAAGCGTACTTACTAGTTTTCATTCTTATTTGACAGTGTAAGCCAATTT
TTAACATAGAGTATTATATGTAAAAAGTGAAAATTTCTTATACCAATATGTACCGTTGTTTATTATTCTATACAAAGATATGGAGTTAAC
AGTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan