ESTScan Details for Unigene SGN-U567611

Score 
328
Direction 
Forward
Predicted Peptide Sequence 
CAKLEDIERGKLIHSSISKTPALSNVFVGSALINMYAKCGHLPEAIQIFDNMPEKNLVSWKAMIVAYAKNGNCGEALKLMYRMQVEGIEV
DDYILATVLTACGEYKETIKSKSKYFLHPNSSXNLNRYESPQEASAKYNNISSVNDDFGHVSMTAEPEXLNVKSLDHSYSSSAYFWTMMD
MSIAPASPDKEXRYSLSDSAFRGP*
Predicted Coding Sequence 
TGTGCAAAGCTGGAAGATATCGAGAGAGGGAAGCTGATCCATTCCTCTATAAGCAAGACACCTGCTCTGTCCAATGTGTTTGTGGGCAGT
GCATTGATCAATATGTATGCAAAATGTGGACATCTTCCTGAGGCAATTCAAATATTTGATAACATGCCCGAGAAGAATTTGGTTTCTTGG
AAGGCGATGATTGTTGCTTATGCTAAAAACGGAAACTGTGGAGAGGCATTGAAGCTCATGTATCGTATGCAAGTAGAGGGCATTGAGGTG
GATGATTATATCCTCGCTACTGTTCTCACAGCATGCGGAGAATATAAGGAAACTATCAAGTCCAAATCGAAGTATTTCTTGCATCCAAAT
AGTTCTXATAACCTAAACAGATATGAGTCTCCTCAAGAAGCTTCAGCGAAATACAACAACATATCCAGTGTAAATGATGATTTCGGTCAT
GTCTCAATGACAGCTGAACCTGAGCXGCTTAATGTTAAGAGTCTGGATCATAGCTATTCGTCATCGGCTTACTTCTGGACCATGATGGAC
ATGTCTATAGCCCCTGCCTCGCCAGATAAAGAAXTGAGGTACAGTTTATCGGACTCTGCTTTTAGAGGTCCATAA
Edits in Original Sequence 
(5')TGTGCAAAGCTGGAAGATATCGAGAGAGGGAAGCTGATCCATTCCTCTATAAGCAAGACACCTGCTCTGTCCAATGTGTTTGTGGG
CAGTGCATTGATCAATATGTATGCAAAATGTGGACATCTTCCTGAGGCAATTCAAATATTTGATAACATGCCCGAGAAGAATTTGGTTTC
TTGGAAGGCGATGATTGTTGCTTATGCTAAAAACGGAAACTGTGGAGAGGCATTGAAGCTCATGTATCGTATGCAAGTAGAGGGCATTGA
GGTGGATGATTATATCCTCGCTACTGTTCTCACAGCATGCGGAGAATATAAGGAAACTATCAAGTCCAAATCGAAGTATTTCTTGCATCC
AAATAGTTCTXATAACCTAAACAGATATGAGTCTCCTCAAGAAGCTTCAGCGAAATACAACAACATATCCAGTGTAAATGATGATTTCGG
TCATGTCTCAATGACAGCTGAACtCTGAGCXGCTTAATGTTAAGAGTCTGGATCATAGCTATTCGTCATCGGCTTACTTCTGGACCATGA
TGGACATGTCTATAGCCCCTGCCTCGCCAGATAAAGAAXTGAGGTACAGTTTATCGGACTCTGCTTTTAGAGGTCCATAA(3')TATTCG
AACGTTGTATCTTCTAACCTCAGTGATACTCTGTATTATACGTAGGTTAGGTCCCTACGACTGCGTATTGTCATATTAAGATCATGTATA
CTTGAACTTTTTCTTAGCGAAGTGATAAAGAAAAGGTTATAACAACAACTATGTATACTAAATATTTGAATGTTAAAAATATACTAGTAT
CATTCATGATGTCTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan