ESTScan Details for Unigene SGN-U567698

Score 
848
Direction 
Forward
Predicted Peptide Sequence 
XRPLFFPTSDFLHKGRKCIHGHYLAEINFXKAEMLLSKKNDLGSGNAFSWPPIASRTPFENLSYFSTSSSSSSPRVSRMATEASSSSSSS
SSSSASPSPSSAIDFLTLCHHLKTTKREGWVRRGVNNPESIADHMYRMGVMALIAADLPGVDRDKCVKMAIVHDIAEAIVGDITPADGVP
KDEKSRRERAALEDMCKLLGGGSRAKEISDLWMEYEENSSLEAKVVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTEVGKAWAS
EVASRRKKSN*
Predicted Coding Sequence 
XXACGTCCTTTGTTTTTCCCTACTTCTGATTTCCTCCATAAAGGGAGAAAGTGCATCCATGGGCATTATCTTGCTGAGATCAATTTCAXC
AAAGCTGAAATGTTGTTGTCAAAGAAAAATGACTTAGGAAGCGGTAACGCCTTCTCATGGCCTCCGATTGCGTCACGGACTCCATTTGAA
AATCTTTCATACTTTTCAACTTCTTCGTCTTCATCATCTCCTAGGGTTTCGCGTATGGCTACCGAAGCTTCATCTTCATCTTCATCTTCA
TCGTCGTCATCTGCATCTCCGTCTCCTTCCTCTGCCATCGATTTTTTAACCCTTTGTCACCACCTCAAGACGACAAAAAGAGAAGGTTGG
GTACGTAGAGGGGTTAATAATCCTGAGTCTATAGCTGATCACATGTACCGTATGGGAGTAATGGCTCTTATTGCTGCTGACCTTCCTGGA
GTTGATCGTGACAAGTGTGTTAAGATGGCAATTGTGCATGACATTGCAGAAGCAATTGTTGGAGATATCACTCCTGCTGATGGGGTTCCA
AAGGACGAAAAGAGTAGACGAGAGCGAGCAGCACTAGAAGACATGTGTAAACTTTTAGGTGGAGGATCCCGAGCCAAGGAAATCAGTGAT
TTATGGATGGAATATGAAGAAAATTCTTCTTTAGAAGCCAAAGTTGTGAAGGACTTCGACAAGGTGGAGATGATACTTCAGGCATTGGAA
TATGAAAATGAGCAAGGGAAGGATTTGGAAGAATTTTTCCAGTCAACTGCAGGTAAGTTCCAAACAGAGGTGGGCAAAGCTTGGGCTTCA
GAGGTAGCATCAAGAAGAAAGAAATCCAACTAA
Edits in Original Sequence 
(5')XXACGTCCTTTGTTTTTCCCTACTTCTGATTTCCTCCATAAAGGGAGAAAGTGCATCCATGGGCATTATCTTGCTGAGATCAATTT
CAXCAAAGCTGAAATGTTGTTGTCAAAGAAAAATGACTTAGGAAGCGGTAACGCCTTCTCATGGCCTCCGATTGCGTCACGGACTCCATT
TGtAAAATCTTTCATACTTTTCAACTTCTTCGTCTTCATCATCTCCTAGGGTTTCGCGTATGGCTACCGAAGCTTCATCTTCATCTTCAT
CTTCATCGTCGTCATCTGCATCTCCGTCTCCTTCCTCTGCCATCGATTTTTTAACCCTTTGTCACCACCTCAAGACGACAAAAAGAGAAG
GTTGGGTACGTAGAGGGGTTAATAATCCTGAGTCTATAGCTGATCACATGTACCGTATGGGAGTAATGGCTCTTATTGCTGCTGACCTTC
CTGGAGTTGATCGTGACAAGTGTGTTAAGATGGCAATTGTGCATGACATTGCAGAAGCAATTGTTGGAGATATCACTCCTGCTGATGGGG
TTCCAAAGGACGAAAAGAGTAGACGAGAGCGAGCAGCACTAGAAGACATGTGTAAACTTTTAGGTGGAGGATCCCGAGCCAAGGAAATCA
GTGATTTATGGATGGAATATGAAGAAAATTCTTCTTTAGAAGCCAAAGTTGTGAAGGACTTCGACAAGGTGGAGATGATACTTCAGGCAT
TGGAATATGAAAATGAGCAAGGGAAGGATTTGGAAGAATTTTTCCAGTCAACTGCAGGTAAGTTCCAAACAGAGGTGGGCAAAGCTTGGG
CTTCAGAGGTAGCATCAAGAAGAAAGAAATCCAACTAA(3')ATTGTTGTGGTAGTCAAAGCTGGATAACAACTTGCACCAGTTGTATTG
CTGATGACCCAAATTCTAAAGGTTACAGGATCACTTGAAATAGAAGGATTCCTAAAATAGCCCCATGGATTCTCTCAACTTAAAAAGAAA
CGTTTGTTTTGCCTTTTTGCTTTTAAAAGTTCTGCAACTAGGAAAATGCTCAACTTTGGTATTTTCAGATTTTGGTTTTTAATTCACACA
ACTCAAATCTAAAAATTGGCTAAATCTATAAAGAAAGAAGCTTAAAGATTCCCCTCACCCAAATTAGCCAAATCATTTCAAGTGTTTTAT
CACGAAAGTGATCAAGCAAGCAGGTGATGATGGTTCAGTTAGTAAGCTAACAATCTTACGAAATGATGGAAGAGAAGACCCTGATAGTTT
GTGTATTGATAATTATATTTCCTATGTTTTAATTTATATGCCTCACTTTTCTTTTAAGTTCTTTTTTTAAAAAATACTATATTTTTATAT
TTAGTAATAATTTAATTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan