ESTScan Details for Unigene SGN-U567896

Score 
885
Direction 
Forward
Predicted Peptide Sequence 
MEDVCEGKDFSFPNQEEKILQWWEEVKAFENQLEKTKNQPEYIFYDGPPFATGLPHYGHILAGTIKDIXDQVSINDGSSCDPKIWVGLHG
LPVEHEIDEKLQIKTKQQVIEMGIDKYNEECRAIVTRYVGEWEKTVVRMGRWIDFQNGYKTMDLKYMESLWWVFAKLHEKGLVYRGFKVM
PYSTGLKTPLSNFEANSNYKEVSDPEIMVSFPIVDDPEGASFVAWTTTPWTLPSNLALCVNANFVYVKVRNKFNGKIYVVAESRLAELPV
EKAKKVAPKGPAADTQIPKSXDKPSGGN
Predicted Coding Sequence 
ATGGAAGATGTATGTGAAGGCAAAGATTTCTCTTTCCCAAATCAAGAAGAAAAAATCCTTCAATGGTGGGAAGAAGTCAAAGCATTCGAA
AACCAGCTCGAAAAGACAAAAAATCAACCCGAATACATTTTCTACGATGGTCCTCCATTTGCAACAGGTTTACCTCATTACGGCCACATA
TTAGCAGGTACAATCAAAGATATTGXTGACCAGGTATCAATCAATGACGGGTCATCATGTGACCCGAAGATTTGGGTGGGATTGCATGGA
TTACCAGTTGAACATGAAATTGATGAGAAACTTCAGATTAAGACTAAACAACAAGTGATTGAAATGGGGATTGATAAGTATAATGAGGAA
TGTAGAGCTATTGTGACAAGGTATGTTGGAGAATGGGAAAAAACTGTGGTGAGAATGGGGAGATGGATTGATTTTCAGAATGGGTATAAG
ACTATGGATTTGAAGTATATGGAGAGTCTTTGGTGGGTTTTTGCTAAGCTGCATGAAAAGGGTCTTGTTTATAGAGGCTTCAAGGTTATG
CCTTATAGTACTGGTTTGAAGACTCCATTATCCAATTTTGAAGCTAATTCAAATTACAAGGAAGTAAGCGACCCCGAAATCATGGTTTCA
TTCCCTATAGTTGATGATCCTGAGGGTGCATCCTTTGTTGCATGGACTACTACTCCTTGGACCCTTCCAAGTAATCTTGCTCTTTGTGTC
AACGCCAATTTTGTATACGTCAAGGTTCGCAATAAATTCAACGGGAAGATCTATGTAGTGGCGGAATCTCGATTGGCTGAGCTACCAGTT
GAGAAAGCCAAAAAGGTCGCTCCAAAGGGACCTGCTGCTGACACTCAAATCCCAAAATCTAAXGACAAGCCTTCGGGTGGTAAT
Edits in Original Sequence 
CTCTATCAGTGTAGCTCTTAAACCCTAGGAATTTTTTTACATCTCTCCACGCCGATTCTATCTTTCTCTCCTCTCCACTCCACATCA(5')
ATGGAAGATGTATGTGAAGGCAAAGATTTCTCTTTCCCAAATCAAGAAGAAAAAATCCTTCAATGGTGGGAAGAAGTCAAAGCATTCGA
AAACCAGCTCGAAAAGACAAAAAATCAACCCGAATACATTTTCTACGATGGTCCTCCATTTGCAACAGGTTTACCTCATTACGGCCACAT
ATTAGCAGGTACAATCAAAGATATTGXTGACCAGGTATCAATCAATGACGGGTCATCATGTGACCCGAAGATTTGGGTGGGATTGtCATG
GATTACCAGTTGAACATGAAATTGATGAGAAACTTCAGATTAAGACTAAACAACAAGTGATTGAAATGGGGATTGATAAGTATAATGAGG
AATGTAGAGCTATTGTGACAAGGTATGTTGGAGAATGGGAAAAAACTGTGGTGAGAATGGGGAGATGGATTGATTTTCAGAATGGGTATA
AGACTATGGATTTGAAGTATATGGAGAGTCTTTGGTGGGTTTTTGCTAAGCTGCATGAAAAGGGTCTTGTTTATAGAGGCTTCAAGGTTA
TGCCTTATAGTACTGGTTTGAAGACTCCATTATCCAATTTTGAAGCTAATTCAAATTACAAGGAAGTAAGCGACCCCGAAATCATGGTTT
CATTCCCTATAGTTGATGATCCTGAGGGTGCATCCTTTGTTGCATGGACTACTACTCCTTGGACCCTTCCAAGTAATCTTGCTCTTTGTG
TCAACGCCAATTTTGTATACGTCAAGGTTCGCAATAAATTCAACGGGAAGATCTATGTAGTGGCGGAATCTCGATTGGCTGAGCTACCAG
TTGAGAAAGCCAAAAAGGTCGCTCCAAAGGGACCTGCTGCTGACACTCAAATCCCAAAATCTAAXGACAAGCCTTCGGGTGGTAAT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan