ESTScan Details for Unigene SGN-U567898

Score 
104
Direction 
Forward
Predicted Peptide Sequence 
XLGFAIWEPPHGRYKMHKNPWRDFVKLSSELRHCAFMVMAXTWMYPIKNSSLIL*
Predicted Coding Sequence 
XXGCTAGGATTTGCTATTTGGGAGCCACCTCATGGACGTTATAAAATGCACAAGAATCCATGGAGAGATTTTGTCAAATTAAGCAGTGAA
TTGAGGCATTGTGCATTCATGGTTATGGCATTXACATGGATGTATCCAATCAAAAATTCAAGTCTTATTCTCTAA
Edits in Original Sequence 
(5')XXGCTAGGATTTGCTATTTGGGAGCCACCTCATGGACGTTATAAAATGCACAAGAATCCATGGAGAGATTTTGTCAAATTAAGCAG
TGAATTGAGGCATTGTGCATTCATGGTTATGGCATTXACATGGATGTATCCAATCAAAAATTCAAGTCTTATTCTCTAA(3')TTAACTG
GTGTCGTCATATCTCTATATCGTTCTTAAAAAATGTGTTATTTTTGAAAAATTTGACACATAAAACTGATTCAGAATTTTCATTTAAAAA
ACAAACAAACATATTATTACTAAAAAAATGAACTCCAAAGTCCATTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan