Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U568367

Score 
-46
Direction 
Forward
Predicted Peptide Sequence 
MTVFNXMNVLRPYFHQYVIGGADHESTAVIGVQIFEKSSGGMVSLCISKTFGFIVVIXVAFRQDEXKTELNCRINPTVLGTKPKVSNGHS
AVLLNGDRILVIKGNSKSDDAFGFLRSVNLWPLDNXNVLIMSVKLGRXGSHAESVLIAQISIPPNXLIGDAGGWITGVPCLYLSILIRKK
VKNVIIERQLTVEYHSVPLNEFNLLAPLFPSYAKNCYIHFVGGHLIYKRTGKAYGTEVVAWSKGVLGNVEKPIVISGPSGVGKGTLISEL
MKEFPSMFGFSVSHTTRAPREKEQNGFHYHFSDRSVMEREIKDGKFLEFASVHGNLYGTSVEAIEVVADAGKRCTLHTDVQGAGXSQNIF
FDSNISKYYLEVYKNEIKLLLMSFIIYQKFTTKVEARLLYSELNPLDSVGKAFENIFXIIKEEKEIVFLFGGCNENICKFQFRYILWENG
SPSLCYVLMKNSFCHIVKKMNFAPKSSQNYSLSEXLKDHIKRLPKLLGLGAGADTCXRSRGRILRDLIFKIQGYGSMYVSCSGIHLKISK
NRVIKPKXMRYYVENLKRYFLVRPQQSXPLHYDSRTFTTDSPLHVQDKLSSSTLHRGKSIFLVQGLKHYEFYYSLKSSFAQLDKEICCWF
GXNPKFLFVSSTPSRPSKFPASHPNQKKNKYNLQKMKIGCSSNKCELTSGSYIDLLMASLMGQVVLSILIDPSITNLSSLLFLCDCAACI
LDIDVQGARSVRASSLEAIFIFISPPSFEELEKRLRARATETEEQIQKRLRNARAELEQGNSSGLFDHILVNDDLESCYENLKVRFAPLI
GNIFYSCKVLVNIFLVYLNANDQVMHLVMLLLELPIYENILGLTEGVKTAHKTYSELVDLPVEHLVSKIDQKILINCGAGEYEKASDSMY
VLDLSLVKGGAPGRTRGLNLFVTNPSTDRVNDXKSAELTYHLLVSIIVFHFLHLYTGREPQFDYVISYMDSLVPDAAIK*
Predicted Coding Sequence 
ATGACTGTATTCAATGXAATGAATGTTCTGCGTCCCTATTTTCACCAGTATGTGATTGGCGGGGCTGATCATGAGTCGACAGCGGTAATT
GGAGTTCAAATATTTGAGAAATCTAGTGGXGGAATGGTGAGTTTATGTATATCTAAAACTTTTGGATTCATTGTGGTTATTXATGTAGCT
TTTAGACAAGATGAAXCAAAAACTGAATTAAATTGCAGGATAAACCCCACTGTGCTGGGTACTAAACCCAAGGTCTCAAATGGCCACTCA
GCTGTGCTTTTAAATGGTGATCGTATATTGGTTATTAAGGGCAATTCCAAGTCTGATGATGCTTTTGGTTTCTTGAGGTCTGTTAATTTA
TGGCCTTTAGATAATXTAAACGTTCTTATTATGTCTGTTAAACTTGGACGTCAXGGATCTCATGCTGAATCTGTGTTGATTGCTCAGATC
AGCATTCCTCCTAATGXTTTAATTGGAGATGCCGGTGGGTGGATCACTGGAGTTCCCTGTTTGTACTTATCCATCCTAATTAGGAAAAAA
GTAAAAAATGTGATTATCGAGAGACAATTAACAGTTGAATATCATTCGGTACCCTTGAATGAGTTTAATTTGCTGGCACCACTTTTTCCA
AGTTATGCTAAAAATTGTTACATACATTTTGTAGGTGGGCACCTCATTTATAAGAGAACAGGAAAAGCATATGGAACTGAGGTGGTTGCC
TGGAGTAAGGGAGTTTTAGGTAATGTGGAGAAGCCTATTGTCATTAGTGGCCCTTCTGGAGTGGGGAAGGGTACCTTGATATCTGAACTA
ATGAAAGAGTTCCCATCTATGTTTGGATTTTCTGTGAGCCACACGACCCGGGCCCCAAGAGAAAAAGAGCAGAATGGATTTCATTACCAT
TTCAGTGACCGCAGTGTAATGGAGAGAGAGATAAAGGATGGGAAATTCCTGGAGTTTGCTTCTGTTCATGGTAATCTTTATGGAACCAGT
GTCGAAGCAATTGAGGTGGTTGCTGATGCTGGCAAGCGATGCACCCTTCATACTGATGTTCAAGGTGCAGGGXTAAGTCAAAACATTTTC
TTTGATTCCAATATTTCAAAATATTATTTGGAAGTATACAAAAATGAGATTAAACTTCTCTTGATGAGTTTCATCATATATCAGAAATTC
ACCACAAAAGTAGAAGCTAGACTGTTGTACTCTGAACTCAATCCTTTAGACTCGGTGGGAAAGGCATTTGAAAACATTTTTXTTATCATA
AAAGAGGAAAAAGAAATTGTTTTTCTCTTTGGTGGATGCAATGAGAATATATGCAAGTTTCAATTTCGTTACATTCTTTGGGAGAATGGC
TCGCCATCTCTTTGTTATGTTCTGATGAAAAATAGTTTCTGTCACATTGTXAAAAAAATGAACTTTGCACCTAAGTCGTCCCAAAACTAC
TCATTAAGTGAAAAXCTGAAAGACCATATAAAGAGACTACCTAAGTTGCTTGGACTTGGTGCGGGTGCTGATACCTGTGXTAGGTCTAGA
GGTCGAATCCTTCGTGATCTAATTTTTAAGATTCAGGGATATGGCTCCATGTATGTATCGTGCTCGGGGATTCACCTTAAAATATCTAAA
AATAGAGTTATAAAACCTAAAXTTATGAGATATTATGTGGAGAACCTGAAGAGATACTTTTTAGTTAGACCACAACAGTCTGXTCCTCTG
CACTATGATTCTAGAACCTTCACTACAGATTCCCCATTACATGTTCAGGACAAGTTAAGTTCCTCAACCTTGCATAGAGGTAAGTCTATC
TTTCTTGTCCAAGGTTTGAAACACTATGAGTTTTATTACTCTCTAAAATCTAGCTTCGCTCAACTCGATAAAGAAATTTGTTGCTGGTTT
GGTAGXAACCCGAAGTTTCTTTTTGTGTCTTCTACCCCCAGCCGGCCTTCTAAATTCCCCGCTTCTCACCCCAATCAAAAGAAAAATAAG
TATAACTTGCAAAAAATGAAGATTGGATGTAGTAGTAATAAGTGTGAACTGACTAGTGGGTCTTACATTGACTTGTTAATGGCATCACTC
ATGGGCCAAGTTGTGCTTAGCATATTGATAGATCCTTCTATTACAAATTTGTCAAGCCTTCTATTTTTGTGTGATTGTGCAGCATGCATC
CTTGATATTGATGTTCAAGGTGCAAGGTCTGTGAGAGCTAGCTCTCTTGAAGCTATTTTCATTTTTATATCTCCACCATCATTTGAAGAA
CTTGAGAAGCGCCTTCGTGCAAGAGCAACTGAGACTGAAGAGCAAATCCAAAAGCGTCTCCGAAATGCTAGGGCGGAACTCGAACAAGGA
AACTCATCCGGTCTCTTTGATCATATTTTGGTGAACGATGACCTAGAAAGTTGTTATGAGAATCTTAAGGTGAGGTTTGCTCCTCTCATT
GGTAATATTTTTTACAGTTGTAAGGTTCTAGTTAACATATTTCTTGTTTATCTAAATGCCAATGATCAAGTAATGCATTTAGTTATGCTA
CTTCTTGAACTTCCTATTTATGAGAACATCTTGGGTCTCACTGAAGGTGTGAAGACTGCTCATAAAACATATTCAGAATTAGTCGACTTG
CCTGTTGAACATTTAGTCTCGAAGATTGATCAGAAGATTTTAATTAACTGTGGTGCTGGAGAATATGAAAAGGCATCCGATAGCATGTAT
GTTCTGGACTTGTCTTTGGTTAAAGGAGGGGCCCCAGGACGGACACGAGGACTAAATCTATTTGTGACCAATCCTTCGACTGATAGAGTA
AATGACGAXAAATCAGCTGAGCTAACCTACCACCTTCTGGTTTCAATAATTGTTTTTCACTTCTTACATCTCTATACGGGTAGAGAACCA
CAATTTGACTACGTCATATCTTACATGGATAGTTTAGTCCCTGATGCAGCTATTAAATGA
Edits in Original Sequence 
TGGGGGCTGATTTGATGAAGTGAATGCGACCAAAAAAGCAGCTCTTTGGTCCCCTCTCCTTCTCTTCTCTTCCACATTCCTTGTGAAGAG
TTGCGCCTACAAATATGGCAAACCCTCCTAAGATTTCTTCCACCTTCTTCTTCCTCTCATCATCCTCTTCCTCTTCCTCTTCCTCTTCCA
CCTTCAAACTTGCTGACTTTTCTAACTTTATTCTTTGACATTTATAATACAGATCTCTATCTTCTTCATTCAATACATACACAATACAAT
ACCAAATACAAGATTAATAATATTCTTTCTGCCTAACCTTAAATCTTTGTTTATCAGGTTGAATCTTTTATACAAGGAATACTTACTTAC
ATCTATGGGAGAAGCACCAGCTTTCTTTGCTGATAGTCTCTTGGGAGATTTTCCAAATGGGATCGATTTGAAATCTAAAGGCCACAAAAC
AGCTATTTCTATCGGCTCTAAAATTGTATGATGATTCAACATACTGATTTGATATTCTACTGTGATGTGTATTCTTTCCAATTTTATATA
CCCAA
(5')ATGACTGTATTCAATGXAATGAATGTTCTGCGTCCCTATTTTCACCAGTATGTGATTGGCGGGGCTGATCATGAGTCGACA
GCGGTAATTGGAGTTCAAATATTTGAGAAATCTAGTGGXGGAATGGTGAGTTTATGTATATCTAAAACTTTTGGATTCATTGTGGTTATT
XATGTAGCTTTTAGACAAGATGAAXCAAAAACTGAATTAAATTGCAGGATAAACCCCACTGTGCTGGGTACTAAACCCAAGGTCTCAAAT
GGCCACTCAGCTGTGCTTTTAAATGGTGATCGTATATTGGTTATTAAGGGCAATTCCAAGTCTGATGaATGCTTTTGGTTTCTTGAGGTC
TGTTAATTTATGGCCTTTAGATAATXTAAACGTTCTTATTATGTCTGTTAAACTTGGACGTCAXGGATCTCATGCTGAATCTGTGTTGAT
TGCTCAGATCAGCATTCCTCCTAATGXTTTAATTGGAGATGCCGGTGGGTGGATCACTGGAGTTCCCTGTTTGTACTTATCCATCCTAAT
TAGGAAAAAAGTAAAAAATGTGATTATCGAGAGACAATTAACAGtTTGAATATCATTCGGTACCCTTGAATGAGTTTAATTTGCTGGCAC
tCACTTTTTCCAAGTTATGCTAAAAATTGTTACATACATTTTGTAGGTGGGCACCTCATTTATAAGAGAACAGGAAAAGaCATATGGAAC
TGAGGTGGTTGCCTGGAGTAAGGGAGTTTTAGGTAATGTGGAGAAGCCTATTGTCATTAGTGGCCCTTCTGGAGTGGGGAAGGGTACCTT
GATATCTGAACTAATGAAAGAGTTCCCATCTATGTTTGGATTTTCTGTGAGCCACACGACCCGGGCCCCAAGAGAAAAAGAGCAGAATGG
ATTTCATTACCATTTCAGTGACCGCAGTGTAATGGAGAGAGAGATAAAGGATGGGAAATTCCTGGAGTTTGCTTCTGTTCATGGTAATCT
TTATGGAACCAGTGTCGAAGCAATTGAGGTGGTTGCTGATGCTGGCAAGCGATGCACCCTTCATACTGATGTTCAAGGTGCAGGGXTAAG
TCAAAACATTTTCTTTGATTCCAATATTTCAAAATATTATTTGGAAGTATACAAAAATGAGATTAAACTTCTCTTGATGtAGTTTCATCA
TATATCAGAAATTCACCACAAAAGTAGAAGCgTAGACTGTTGTACTCTGAACTCAATCCTTTAGACTCGGTGGGAAAGGCATTTGAAAAC
ATTTTTXTTATCATAAAAGAGGAAAAAGAAATTGTTTTTCTCTTTGGTGGATGCAATGAGAATATATGCAAGTTTCAATTTCGTTACATT
CTTTGGGAGAATGGCTCGCCATCTCTTTGTTATGTTCTGATGAAAAATAGTTTCTGTCACATTGTXAAAAAAATGAACTTTGCACCTAAG
TCGTCCCAAAACTAgCTCATTAAGTGAAAAXCTGAAAGACCATATAAAGAGACTACCTAAGTTGCTTGGACTTaGGTGCGGGTGtCTGAT
ACCTGTGXTAGGTCTAGAGGTCGAATCCTTCGTGATCTAATTTTTAAGATTCAGGGATATGGCTCCATGTATGTATaCGTGCTCGGGGAT
TCACCTTAAAATATCTAAAAATAGAGTTATAAAACCTAAAXTTATGAGATATTATGTGGAGAACCTGAAGAGATACTTTTTAGTTAGACC
ACAACAGTCTGXTCCTCTGCACTATGATTCTAGAACCTTCACTACAGATTCCCCATTACATGTTCAGGACAAGTTAAGTTCCTCAACCTT
GCATAGAGGTAAGTCTATCTTTCTTGTCCAAGGTTTGAAACACTAgTGAGTTTTATTACTCTCTAAAATCTAGCTTCGCTCAACTCGATA
AAGAAATTTGTTGCTGGTTTGGTAGXAACCCGAAGTTTCTTTTTGTGTCTTCTACCCCCAGCCGGCCTTCTAAATTCCCCGCTTCTCACC
CCAATCAAAAGAtAAAATAAGTATAACTTGCAAAAAATGAAGATcTGGATGTAGTAGTAATAAGTGTGAACTGACTAGTGGGTCTTACAT
TGACTTGTTAATGGCATCACTCATGGGCCAAGTTGTGCaTTAGCATATTGATAGATCCTTCTATTACAAATTTGTCAAGCCTTCTATTTT
TGTGTGATTGTGCAGCgATGCATCCTTGATATTGATGTTCAAGGTGCAAGGTCTGTGAGAGCTAGCTCTCTTGAAGCTATTTTCATTTTT
ATATCTCCACCATCATTTGAAGAACTTGAGAAGCGCCTTCGTGCAAGAGCAACTGAGACTGAAGAGCAAATCCAAAAGCGTCTCCGAAAT
GCTAGGGCGGAACTCGAACAAGGAAACTCATCCGGTCTCTTTGATCATATTTTGGTGAACGATGACCTAGAAAGTTGTTATGAGAATCTT
AAGGTGAGGTTTGCTCCTCTCATTGtGTAATATTTTTTACAGTTGTAAGGTTCTAGTTAACATATTTCTTGTTTATCTAAATGtCCAATG
ATCAAGTAATGCATTTAGTTATGCTACTTCTTGtAACTTCCTATTTATGtAGAACATCTTGGGTCTCACTGAAGGTGTGAAGACTGCTCA
TAAAACATATTCAGAATTAGTCGACTTGCCTGTTGAACATTTAGTCTCGAAGATTGATCAGAAGATTTTAATTAACTGTGGTGCTGGAGA
ATATGAAAAGGCATCCGATAGCATGTATGTTCTGGACTTGTCTTTGGTTAAAGGAGGGGCCCCAGGACGGACACGAGGACTAAATCTATT
TGTGACCAATCCTTCGACTGATAGAGTAAATGACGAXAAATCAGCTGAGCTAACCTACCACCTTCTGGTTTCAATAATTGTTTTTCACTT
CTTACATCTCTATACGGGTAGAGAACCACAATTTGACTACGTCATATCTTACATGGATAGTTTAGTCCCTGATGCAGCTATTAAATGA(3')
GAAATGATTTCTAATTATTAAAAAATTGTAGGTTAGCAGCCTGAACTATTGAAAGCCTAAGATATGTAACTCTTCTACTCGAGGATTG
AGCATGTTGGATGTAATTCTTTCAGCTTTTTCTATAGCTTGCTTATTCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan