Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U568369

Score 
867
Direction 
Forward
Predicted Peptide Sequence 
XIRLNLLYKEYLLTSMGEAPAFFADSLLGDFPNGIDLKSKGHKTAISMALKLYDDSTTDLIFYCDXVFFPILYTQMTVFNXMNVLRPYFH
QYVIGGADHESTAVIGVQIFEKSSGEWINPTVLGTKPKVSNGHSAVLLNGDRILVIKGNSKSDECFWFLEVGTSFIREQEKTYGTEVVAW
SKGVLGNVEKPIVISGPSGVGKGTLISELMKEFPSMFGFSVSHTTRAPREKEQNGFHYHFSDRSVMEREIKDGKFLEFASVHGNLYGTSV
EAVEVVADAGKRCILDIDVQGARSVRASSLEAIFIFISPPSFEELEKRLRARATETEEQIQKRLRNARAELEQGNSSGLFDHILVNDDLE
SCYENLKNILGLTEGVKTAHKTYSELVDLPVEHLVSKIDQKILINCGAGEYEKASDSMYVLDLSLVKGGAPGRTRGLNLFVTNPSTDRVN
DXKSAELTYHLLVSIIVFHFLHLYTGREPQFDYVISYMDSLVPDAAIK*
Predicted Coding Sequence 
XXTATCAGGTTGAATCTTTTATACAAGGAATACTTACTTACATCTATGGGAGAAGCACCAGCTTTCTTTGCTGATAGTCTCTTGGGAGAT
TTTCCAAATGGGATCGATTTGAAATCTAAAGGCCACAAAACAGCTATTTCTATGGCTCTAAAATTGTATGATGATTCAACAACTGATTTG
ATATTCTACTGTGATGXTGTATTCTTTCCAATTTTATATACCCAAATGACTGTATTCAATGXAATGAATGTTCTGCGTCCCTATTTTCAC
CAGTATGTGATTGGCGGGGCTGATCATGAGTCGACAGCGGTAATTGGAGTTCAAATATTTGAGAAATCTAGTGGGGAATGGATAAACCCC
ACTGTGCTGGGTACTAAACCCAAGGTCTCAAATGGCCACTCAGCTGTGCTTTTAAATGGTGATCGTATATTGGTTATTAAGGGCAATTCC
AAGTCTGATGAATGCTTTTGGTTTCTTGAGGTGGGCACCTCATTTATAAGAGAACAGGAAAAGACATATGGAACTGAGGTGGTTGCCTGG
AGTAAGGGAGTTTTAGGTAATGTGGAGAAGCCTATTGTCATTAGTGGCCCTTCTGGAGTGGGGAAGGGTACCTTGATATCTGAACTAATG
AAAGAGTTCCCATCTATGTTTGGATTTTCTGTGAGCCACACGACCCGGGCCCCAAGAGAAAAAGAGCAGAATGGATTTCATTACCATTTC
AGTGACCGCAGTGTAATGGAGAGAGAGATAAAGGATGGGAAATTCCTGGAGTTTGCTTCTGTTCATGGTAATCTTTATGGAACCAGTGTC
GAAGCAGTTGAGGTGGTTGCTGATGCTGGCAAGCGATGCATCCTTGATATTGATGTTCAAGGTGCAAGGTCTGTGAGAGCTAGCTCTCTT
GAAGCTATTTTCATTTTTATATCTCCACCATCATTTGAAGAACTTGAGAAGCGCCTTCGTGCAAGAGCAACTGAGACTGAAGAGCAAATC
CAAAAGCGTCTCCGAAATGCTAGGGCGGAACTCGAACAAGGAAACTCATCCGGTCTCTTTGATCATATTTTGGTGAACGATGACCTAGAA
AGTTGTTATGAGAATCTTAAGAACATCTTGGGTCTCACTGAAGGTGTGAAGACTGCTCATAAAACATATTCAGAATTAGTCGACTTGCCT
GTTGAACATTTAGTCTCGAAGATTGATCAGAAGATTTTAATTAACTGTGGTGCTGGAGAATATGAAAAGGCATCCGATAGCATGTATGTT
CTGGACTTGTCTTTGGTTAAAGGAGGGGCCCCAGGACGGACACGAGGACTAAATCTATTTGTGACCAATCCTTCGACTGATAGAGTAAAT
GACGAXAAATCAGCTGAGCTAACCTACCACCTTCTGGTTTCAATAATTGTTTTTCACTTCTTACATCTCTATACGGGTAGAGAACCACAA
TTTGACTACGTCATATCTTACATGGATAGTTTAGTCCCTGATGCAGCTATTAAATGA
Edits in Original Sequence 
(5')XXTATCAGGTTGAATCTTTTATACAAGGAATACTTACTTACATCTATGGGAGAAGCACCAGCTTTCTTTGCTGATAGTCTCTTGGG
AGATTTTCCAAATGGGATCGATTTGAAATCTAAAGGCCACAAAACAGCTATTTCTATcGGCTCTAAAATTGTATGATGATTCAACAtACT
GATTTGATATTCTACTGTGATGXTGTATTCTTTCCAATTTTATATACCCAAATGACTGTATTCAATGXAATGAATGTTCTGCGTCCCTAT
TTTCACCAGTATGTGATTGGCGGGGCTGATCATGAGTCGACAGCGGTAATTGGAGTTCAAATATTTGAGAAATCTAGTGGGGAATGGATA
AACCCCACTGTGCTGGGTACTAAACCCAAGGTCTCAAATGGCCACTCAGCTGTGCTTTTAAATGGTGATCGTATATTGGTTATTAAGGGC
AATTCCAAGTCTGATGAATGCTTTTGGTTTCTTGAGGTGGGCACCTCATTTATAAGAGAACAGGAAAAGACATATGGAACTGAGGTGGTT
GCCTGGAGTAAGGGAGTTTTAGGTAATGTGGAGAAGCCTATTGTCATTAGTGGCCCTTCTGGAGTGGGGAAGGGTACCTTGATATCTGAA
CTAATGAAAGAGTTCCCATCTATGTTTGGATTTTCTGTGAGCCACACGACCCGGGCCCCAAGAGAAAAAGAGCAGAATGGATTTCATTAC
CATTTCAGTGACCGCAGTGTAATGGAGAGAGAGATAAAGGATGGGAAATTCCTGGAGTTTGCTTCTGTTCATGGTAATCTTTATGGAACC
AGTGTCGAAGCAGTTGAGGTGGTTGCTGATGCTGGCAAGCGATGCATCCTTGATATTGATGTTCAAGGTGCAAGGTCTGTGAGAGCTAGC
TCTCTTGAAGCTATTTTCATTTTTATATCTCCACCATCATTTGAAGAACTTGAGAAGCGCCTTCGTGCAAGAGCAACTGAGACTGAAGAG
CAAATCCAAAAGCGTCTCCGAAATGCTAGGGCGGAACTCGAACAAGGAAACTCATCCGGTCTCTTTGATCATATTTTGGTGAACGATGAC
CTAGAAAGTTGTTATGAGAATCTTAAGAACATCTTGGGTCTCACTGAAGGTGTGAAGACTGCTCATAAAACATATTCAGAATTAGTCGAC
TTGCCTGTTGAACATTTAGTCTCGAAGATTGATCAGAAGATTTTAATTAACTGTGGTGCTGGAGAATATGAAAAGGCATCCGATAGCATG
TATGTTCTGGACTTGTCTTTGGTTAAAGGAGGGGCCCCAGGACGGACACGAGGACTAAATCTATTTGTGACCAATCCTTCGACTGATAGA
GTAAATGACGAXAAATCAGCTGAGCTAACCTACCACCTTCTGGTTTCAATAATTGTTTTTCACTTCTTACATCTCTATACGGGTAGAGAA
CCACAATTTGACTACGTCATATCTTACATGGATAGTTTAGTCCCTGATGCAGCTATTAAATGA(3')GAAATGATTTCTAATTATTAAAA
AATTGTAGGTTAGCAGCCTGAACTATTGAAAGCCTAAGATATGTAACTCTTCTACTCGAGGATTGAGCATGTTGGATGTAATTCTTTCAG
CTTTTTCTATAGCTTGCTTATTCATATCTCTTTTTTTCTTACACTGGTTGCTTCTGTTTATTTCATTGTTTCCCGTGGGGAGGTATTTTT
GCTTGCTCTAAGTGAAACATTTAAAACGTGACATGTAAAAATGAATGAAGTAAGGAATATTATTATTGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan