ESTScan Details for Unigene SGN-U568481

Score 
1458
Direction 
Forward
Predicted Peptide Sequence 
XQNGRAGGKEEADSAAASGALEYSGRHTTSSLSVLAGNDSKAESLSPRERAAERERMVLDIKVKLQGLWVRLVNLGQTDDPLSSFEYGTI
LALIESDAEGIGGSGFVECIREHIHSGLNCQLSEEQFIAVKELLKTTINLAMSRNDMATVRDALEVSAEMYKKDINNVSDYVQRHLRSLS
IWEELRFWEGYFDCLLDRYSSKSTNYATLVTTQLIVLATHMAGLGLHDTDAWYMIETIAGKNNIGYKHIIKLRGYLSHVRHMFVGYWGIH
SVKLQSASTLGLLSPRAQDASDDAQQPAEASGIGRSWVQSMFSRDTSIRAKSFGRVGKWSSDSGTLASSENGTPRKQDLSAAGQKKMQTS
IRTLRGHSGAVTAIHCVTKREVWDLVGDREDAGFFISGSTDCTVKIWDPSLRGAELRATLNGHTRTVRAISSDRGKVVSGSDDHSILVWD
KQTTQLLEELKGHNAQVSYVRMLSGERVLTAAHDGTVKMWDVRTDTCVATVGRCSGAVLCMEYDDSTGVLAAAGRDAVANIWDVRAGRQM
HKLMGHTKWIRSIRMVGDTVITGSDDWTARIWSVSRGQCDAVLACHAGPILCVEYSSADKGIITGSSDGLLRFWENDDGGIRCIKNVTIH
TASILSIDAGEHWLGIGAADNSMSLFHRPQERLGGFSSAGSKMAGWQLYRTPQKTAAMVRCVASDLERKRICSGGRNGLLRLWDATINI*
Predicted Coding Sequence 
XGTCAGAACGGAAGAGCAGGAGGAAAAGAGGAAGCAGATTCTGCAGCAGCAAGTGGAGCACTTGAATATTCTGGGAGGCATACTACTAGT
TCACTTTCAGTACTTGCTGGAAATGATTCAAAGGCCGAAAGTCTAAGCCCCAGAGAGCGAGCTGCAGAGAGGGAACGTATGGTTTTGGAC
ATAAAAGTTAAGCTTCAGGGATTGTGGGTACGCCTTGTGAATTTGGGACAAACTGATGATCCTCTTTCCTCCTTTGAATATGGAACCATC
CTCGCACTTATTGAGTCAGATGCTGAAGGAATTGGTGGTAGTGGTTTCGTTGAATGTATAAGAGAGCACATTCATTCAGGTTTGAACTGT
CAATTGTCAGAGGAGCAGTTTATTGCAGTCAAAGAACTGCTGAAAACAACAATTAATCTTGCTATGTCTAGGAATGACATGGCAACTGTC
AGAGATGCCCTGGAAGTCTCTGCAGAAATGTACAAGAAGGATATAAACAATGTCTCTGACTATGTTCAACGACATCTTCGTTCTCTTTCT
ATCTGGGAGGAGCTACGTTTCTGGGAAGGATACTTTGATTGTCTACTGGACCGTTATTCTAGCAAGTCAACCAATTATGCAACTTTGGTG
ACAACCCAGCTCATTGTTCTGGCTACTCACATGGCTGGCCTTGGACTTCATGATACTGATGCATGGTACATGATTGAAACAATAGCTGGG
AAAAACAACATTGGGTACAAGCACATTATAAAACTCCGTGGATATTTATCCCATGTCCGGCATATGTTTGTTGGTTACTGGGGAATCCAC
TCAGTTAAGTTACAGTCTGCATCTACCTTGGGATTACTTTCCCCGCGAGCACAGGATGCATCTGATGATGCTCAACAACCTGCTGAGGCA
TCTGGTATCGGAAGAAGCTGGGTCCAGAGCATGTTCAGCAGAGATACGTCAATAAGAGCCAAGTCTTTTGGTCGTGTTGGCAAATGGTCT
TCTGATAGTGGTACTCTAGCTTCAAGCGAGAACGGGACGCCTCGAAAACAAGATCTATCAGCAGCTGGACAAAAGAAAATGCAGACCAGC
ATCCGTACATTAAGGGGTCATAGTGGTGCAGTTACCGCTATACACTGTGTGACGAAAAGAGAGGTTTGGGATTTAGTTGGTGACCGAGAG
GATGCTGGTTTCTTTATTAGTGGAAGCACAGACTGCACGGTGAAGATCTGGGATCCTAGCCTTCGTGGTGCTGAACTTAGGGCTACTCTG
AATGGTCACACAAGGACTGTTAGGGCAATTAGTTCTGACCGAGGGAAGGTGGTATCAGGATCCGATGATCATTCTATTCTTGTATGGGAT
AAACAAACAACACAACTACTTGAAGAATTGAAGGGCCACAATGCACAGGTCAGCTATGTGCGCATGCTTTCAGGTGAACGTGTCCTTACT
GCTGCCCATGATGGGACAGTAAAGATGTGGGATGTAAGAACAGATACTTGTGTTGCTACGGTAGGCCGTTGCTCTGGTGCTGTTCTTTGC
ATGGAGTATGATGACTCAACAGGAGTCTTAGCTGCTGCAGGCAGAGATGCGGTTGCAAACATTTGGGATGTTCGTGCTGGGAGGCAAATG
CACAAGCTTATGGGACATACCAAATGGATAAGATCAATTAGAATGGTGGGAGACACGGTGATAACAGGTAGTGATGATTGGACGGCACGA
ATCTGGTCTGTTTCTAGAGGACAATGTGATGCAGTGCTAGCTTGCCATGCTGGTCCAATTCTATGCGTGGAGTATTCCTCAGCGGACAAA
GGGATAATAACAGGTTCAAGCGATGGTCTTCTGCGGTTCTGGGAAAATGATGATGGCGGCATAAGGTGTATAAAGAATGTCACTATCCAT
ACTGCCTCAATATTGTCCATTGATGCTGGGGAACACTGGTTAGGAATAGGGGCTGCTGATAATTCAATGTCTCTCTTTCACCGTCCTCAA
GAGAGGCTAGGTGGCTTCTCTAGTGCTGGTTCAAAAATGGCGGGATGGCAGCTCTACAGAACTCCTCAGAAAACAGCAGCAATGGTACGA
TGTGTGGCTTCTGATCTTGAAAGGAAAAGGATTTGTAGTGGTGGACGCAATGGGTTGCTTAGACTGTGGGATGCTACTATAAACATCTAG
Edits in Original Sequence 
(5')XGTCAGAACGGAAGAGCAGGAGGAAAAGAGGAAGCAGATTCTaGCAGCAGCAAGTGGAGCACTTGAATATTCTGGGAGGCATACTA
CTAGTTCACTTTCAGTACTTGCTGGAAATGATTCAAAGGCCGAAAGTCTAAGCCCCAGAGAGCGAGCTGCAGAGAGGGAACGTATGGTTT
TGGACATAAAAGTTAAGCTTCAGGGATTGTGGGTACGCCTTGTGAATTTGGGACAAACTGATGATCCTCTTTCCTCCTTTGAATATGGAA
CCATCCTCGCACTTATTGAGTCAGATGCTGAAGGAATTGGTGGTAGTGGTTTCGTTGAATGTATAAGAGAGCACATTCATTCAGGTTTGA
ACTGTCAATTGTCAGAGGAGCAGTTTATTGCAGTCAAAGAACTGCTGAAAACAACAATTAATCTTGCTATGTCTAGGAATGACATGGCAA
CTGTCAGAGATGCCCTGGAAGTCTCTGCAGAAATGTACAAGAAGGATATAAACAATGTCTCTGACTATGTTCAACGACATCTTCGTTCTC
TTTCTATCTGGGAGGAGCTACGTTTCTGGGAAGGATACTTTGATTGTCTACTGGACCGTTATTCTAGCAAGTCAACCAATTATGCAACTT
TGGTGACAACCCAGCTCATTGTTCTGGCTACTCACATGGCTGGCCTTGGACTTCATGATACTGATGCATGGTACATGATTGAAACAATAG
CTGGGAAAAACAACATTGGGTACAAGCACATTATAAAACTCCGTGGATATTTATCCCATGTCCGGCATATGTTTGTTGGTTACTGGGGAA
TCCACTCAGTTAAGTTACAGTCTGCATCTACCTTGGGATTACTTTCCCCGCGAGCACAGGATGCATCTGATGATGCTCAACAACCTGCTG
AGGCATCTGGTATCGGAAGAAGCTGGGTCCAGAGCATGTTCAGCAGAGATACGTCAATAAGAGCCAAGTCTTTTGGTCGTGTTGGCAAAT
GGTCTTCTGATAGTGGTACTCTAGCTTCAAGCGAGAACGGGACGCCTCGAAAACAAGATCTATCAGCAGCTGGACAAAAGAAAATGCAGA
CCAGCATCCGTACATTAAGGGGTCATAGTGGTGCAGTTACCGCTATACACTGTGTGACGAAAAGAGAGGTTTGGGATTTAGTTGGTGACC
GAGAGGATGCTGGTTTCTTTATTAGTGGAAGCACAGACTGCACGGTGAAGATCTGGGATCCTAGCCTTCGTGGTGCTGAACTTAGGGCTA
CTCTGAATGGTCACACAAGGACTGTTAGGGCAATTAGTTCTGACCGAGGGAAGGTGGTATCAGGATCCGATGATCATTCTATTCTTGTAT
GGGATAAACAAACAACACAACTACTTGAAGAATTGAAGGGCCACAATGCACAGGTCAGCTATGTGCGCATGCTTTCAGGTGAACGTGTCC
TTACTGCTGCCCATGATGGGACAGTAAAGATGTGGGATGTAAGAACAGATACTTGTGTTGCTACGGTAGGCCGTTGCTCTGGTGCTGTTC
TTTGCATGGAGTATGATGACTCAACAGGAGTCTTAGCTGCTGCAGGCAGAGATGCGGTTGCAAACATTTGGGATGTTCGTGCTGGGAGGC
AAATGCACAAGCTTATGGGACATACCAAATGGATAAGATCAATTAGAATGGTGGGAGACACGGTGATAACAGGTAGTGATGATTGGACGG
CACGAATCTGGTCTGTTTCTAGAGGACAATGTGATGCAGTGCTAGCTTGCCATGCTGGTCCAATTCTATGCGTGGAGTATTCCTCAGCGG
ACAAAGGGATAATAACAGGTTCAAGCGATGGTCTTCTGCGGTTCTGGGAAAATGATGATGGCGGCATAAGGTGTATAAAGAATGTCACTA
TCCATACTGCCTCAATATTGTCCATTGATGCTGGGGAACACTGGTTAGGAATAGGGGCTGCTGATAATTCAATGTCTCTCTTTCACCGTC
CTCAAGAGAGGCTAGGTGGCTTCTCTAGTGCTGGTTCAAAAATGGCGGGATGGCAGCTCTACAGAACTCCTCAGAAAACAGCAGCAATGG
TACGATGTGTGGCTTCTGATCTTGAAAGGAAAAGGATTTGTAGTGGTGGACGCAATGGGTTGCTTAGACTGTGGGATGCTACTATAAACA
TCTAG(3')GTTTTAAGGGTGACTCCTGCATTTTCTTAGGGATTATGTGTATAAGTTTGCTCTATTTGGTTGCACTAGTCACTACGTACA
TGCATTGTACATGTATCTTGTATAATTTGTACTCAAAATAGATTGGACTTTTAAGCTCGTGAAAATTCTTGAACATTTGTCTGAGTTATA
AAGTTCTTTTCTTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan