ESTScan Details for Unigene SGN-U568502

Score 
297
Direction 
Reverse
Predicted Peptide Sequence 
MELPGNHEHRTSSALERHRDDAIGLSNSSRTLVAAREGRSRLVTEIRNVLDLMRRGEGLSVEDVMILDQSVFFGMPDIQDRHRDMRLDVD
NMSYEELLALGERIGDVCTGLSEETISSRLKQRNFIALKQNNPRKQNHAAYAGRNIATGMVSEHWSVDMISIQTALAMAHAEEFMPGMQD
DGAYYMRKNHIL*
Predicted Coding Sequence 
ATGGAACTTCCTGGAAACCATGAGCATCGCACATCGAGTGCACTGGAGCGACATCGTGATGATGCTATAGGACTCTCCAACTCGTCGAGG
ACTTTGGTTGCTGCACGGGAAGGAAGAAGTAGGCTAGTCACTGAGATTCGCAATGTGTTAGATCTTATGCGCAGGGGTGAAGGGCTAAGT
GTTGAGGATGTTATGATCCTTGATCAGTCGGTGTTCTTTGGGATGCCGGATATTCAAGATCGCCATAGAGATATGCGTCTTGATGTTGAT
AATATGTCATACGAGGAGTTATTGGCACTCGGAGAGCGCATTGGGGATGTTTGCACCGGGCTAAGTGAAGAAACTATTTCAAGTCGTTTG
AAGCAGCGTAACTTTATTGCATTAAAACAGAACAACCCGAGGAAGCAGAACCATGCTGCATATGCCGGGAGGAATATAGCAACGGGGATG
GTCTCGGAACACTGGAGTGTGGACATGATTTCCATACAGACTGCATTAGCAATGGCTCATGCAGAAGAATTTATGCCCGGTATGCAAGAC
GACGGGGCTTACTACATGAGAAAGAACCATATTCTTTGA
Edits in Original Sequence 
AGGAG(5')ATGGAACTTCCTGGAAACCATGAGCATCGCACATCGAGTGCACTGGAGCGACATCGTGATGATGCTATAGGACTCTCCAAC
TCGTCGAGGACTTTGGTTGCTGCACGGGAAGGAAGAAGTAGGCTAGTCACTGAGATTCGCAATGTGTTAGATCTTATGCGCAGGGGTGAA
GGGCTAAGTGTTGAGGATGTTATGATCCTTGATCAGTCGGTGTTCTTTGGGATGCCGGATATTCAAGATCGCCATAGAGATATGCGTCTT
GATGTTGATAATATGTCATACGAGGAGTTATTGGCACTCGGAGAGCGCATTGGGGATGTTTGCACCGGGCTAAGTGAAGAAACTATTTCA
AGTCGTTTGAAGCAGCGTAACTTTATTaGCATTAAAACAGAACAACCCGAGGAAGCAGAACCATGCTGCATATGCCGGGAGGAATATAGC
AACGGGGATGGTCTCGGAACACTGGAGTGTGGACATGATTTCCATACAGACTGCATTaAGCAATGGCTCATGCAGAAGAATTTATGCCCG
GTATGCAAGACGACGGGGCTTACTACATGAGAAAGAACCATATTCTTTGA(3')AAAAATTTATGAATTGGAAGGGGAGTTTGTTCTAGA
GATGAAATTAGCTCTAGCTACATTAGACATTTATTTAGAACAGAATTTGATTTACATTATGGTTCTCTGGAATTTTTACATTTGCTATAG
CGAATTAATTGAATCAACTTTTGGAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan