ESTScan Details for Unigene SGN-U568602

Score 
738
Direction 
Forward
Predicted Peptide Sequence 
MGACASKPKVLEGTAPHVLGEDIMNNNKQEGIVGDDVPNKPHSLSNLFKEGKEGSEEVKEETSTEAQLPKTEETPENKTEDVIESEKEAE
EVIKSEKEETTTEAQNEEIKSEIEENEQVIKSEPETEIINPEVMKTETEISSEKKVAVEEEKPPKKPVVEEKKSGKFWWEK*
Predicted Coding Sequence 
ATGGGAGCATGTGCAAGCAAGCCTAAGGTCTTGGAGGGTACCGCTCCTCATGTGTTGGGAGAAGACATCATGAACAACAACAAGCAAGAA
GGAATTGTGGGCGATGATGTTCCTAATAAGCCTCACTCTCTCAGTAATTTGTTCAAGGAGGGAAAAGAAGGGTCAGAAGAAGTGAAAGAG
GAGACATCCACAGAAGCACAGCTACCAAAGACGGAGGAGACCCCAGAAAATAAAACAGAGGATGTTATAGAATCAGAAAAAGAAGCAGAG
GAAGTTATAAAATCAGAAAAAGAAGAGACAACTACTGAGGCACAGAATGAAGAAATAAAATCAGAAATAGAAGAGAATGAGCAAGTCATA
AAATCCGAACCAGAAACAGAGATAATTAATCCTGAAGTAATGAAAACAGAAACAGAGATTTCCAGTGAGAAGAAAGTTGCAGTAGAGGAA
GAGAAACCACCAAAAAAACCTGTCGTTGAAGAAAAGAAATCAGGAAAATTTTGGTGGGAAAAGTAA
Edits in Original Sequence 
GATTGCCTCTTTCCTCTCTCCAATATAATAATTTGTCTAACTCAACAAGGCCTAAAGGATATTTGATTTGATTAATTTTGTTAATCAAAA
GGCAAAAACA
(5')ATGGGAGCATGTGCAAGCAAGCCTAAGGTCTTGGAGGGTACCGCTCCTCATGTGTTGGGAGAAGACATCATGAACA
ACAACAAGCAAGAAGGAATTGTGGGCGATGATGTTCCTAATAAGCCTCACTCTCTCAGTAATTTGTTCAAGGAGGGAAAAGAAGGGTCAG
AAGAAGTGAAAGAGGAGACATCCACAGAAGCACAGCTACCAAAGACGGAGGAGACCCCAGAAAATAAAACAGAGGATGTTATAGAATCAG
AAAAAGAAGCAGAGGAAGTTATAAAATCAGAAAAAGAAGAGACAACTACTGAGGCACAGAATGAAGAAATAAAATCAGAAATAGAAGAGA
ATGAGCAAGTCATAAAATCCGAACCAGAAACAGAGATAATTAATCCTGAAGTAATGAAAACAGAAACAGAGATTTCCAGTGAGAAGAAAG
TTGCAGTAGAGGAAGAGAAACCACCAAAAAAACCTGTCGTTGAAGAAAAGAAATCAGGAAAATTTTGGTGGGAAAAGTAA(3')ACTAAT
GCTATCAAGTCTCCCTAATTACAGATGGTATGGTATAACTTTTTTAATTCAACAAGTTGGGATGAGCAACGCTTTAAATATTTCATCCTC
ATTATCATACTATATATATTTTTCACCTTATAATTTACTTCTAATTTTATATACAAGTCACAAAGTATGTTTTATTTATGTGAATGCAAG
TGTATCCGACTTTCATATTGTTTTGATACATTTCAATTTCTTTAATTTGTGACACAAAGTATAATTATTGATGAAGGAGCAGTTCAAGTT
CTTATCAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan